![Western Blot: PACSIN1 Antibody [NBP2-33756] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10, Lane 2: Human Cerebral Cortex tissue](http://images.novusbio.com/fullsize/PACSIN1-Antibody-Western-Blot-NBP2-33756-img0006.jpg "Western Blot: PACSIN1 Antibody [NBP2-33756] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10, Lane 2: Human Cerebral Cortex tissue")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGN |
| Predicted Species | Mouse (92%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PACSIN1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Human Cortex lysate as sample; separated by size; antibody dilution of 1:25; observed molecular weight was 65 kDa; matrix was 12-230 kDa; detected by Chemiluminescence. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: PACSIN1 Antibody [NBP2-33756] - Staining of human cell line MCF7 shows localization to nucleus, nucleoli & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PACSIN1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33756-img0005.jpg "Immunocytochemistry/Immunofluorescence: PACSIN1 Antibody [NBP2-33756] - Staining of human cell line MCF7 shows localization to nucleus, nucleoli & vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PACSIN1 Antibody [NBP2-33756] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/PACSIN1-Antibody-Immunohistochemistry-Paraffin-NBP2-33756-img0008.jpg "Immunohistochemistry-Paraffin: PACSIN1 Antibody [NBP2-33756] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: PACSIN1 Antibody [NBP2-33756] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/PACSIN1-Antibody-Immunohistochemistry-Paraffin-NBP2-33756-img0007.jpg "Immunohistochemistry-Paraffin: PACSIN1 Antibody [NBP2-33756] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: PACSIN1 Antibody [NBP2-33756] - Staining in human cerebral cortex and skeletal muscle tissues using anti-PACSIN1 antibody. Corresponding PACSIN1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PACSIN1-Antibody-Immunohistochemistry-Paraffin-NBP2-33756-img0009.jpg "Immunohistochemistry-Paraffin: PACSIN1 Antibody [NBP2-33756] - Staining in human cerebral cortex and skeletal muscle tissues using anti-PACSIN1 antibody. Corresponding PACSIN1 RNA-seq data are presented for the same tissues.")
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Holo-Transferrin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Holo-Transferrin [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")