PAC2 Antibody


Immunohistochemistry: PAC2 Antibody [NBP2-30576] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

PAC2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQ
Specificity of human PAC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PAC2 Protein (NBP2-30576PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PAC2 Antibody

  • HCCA3PAC-2
  • hepatocellular carcinoma susceptibility protein
  • Hepatocellular carcinoma-susceptibility protein 3
  • HsT1707
  • likely ortholog of mouse CD40 ligand-activated specific transcript 3 (Clast3)
  • MDS003
  • MGC15092
  • proteasome (prosome, macropain) assembly chaperone 2
  • proteasome assembling chaperone 2
  • proteasome assembly chaperone 2
  • TNFSF5IP1CD40 ligand-activated specific transcript 3
  • Tumor necrosis factor superfamily member 5-induced protein 1
  • tumor necrosis factor superfamily, member 5-induced protein 1
  • x 003 protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Pm, Bv(-), Ch(-), Rt(-), Ze(-)
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ChIP
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PAC2 Antibody (NBP2-30576) (0)

There are no publications for PAC2 Antibody (NBP2-30576).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAC2 Antibody (NBP2-30576) (0)

There are no reviews for PAC2 Antibody (NBP2-30576). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PAC2 Antibody (NBP2-30576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PAC2 Products

Bioinformatics Tool for PAC2 Antibody (NBP2-30576)

Discover related pathways, diseases and genes to PAC2 Antibody (NBP2-30576). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAC2 Antibody (NBP2-30576)

Discover more about diseases related to PAC2 Antibody (NBP2-30576).

Pathways for PAC2 Antibody (NBP2-30576)

View related products by pathway.

Blogs on PAC2

There are no specific blogs for PAC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PAC2 Antibody and receive a gift card or discount.


Gene Symbol PSMG2