PA28 Activator gamma Subunit/PSME3 Antibody

Western Blot: PA28 Activator gamma Subunit/PSME3 Antibody [H00010197-B01P] - Analysis of PSME3 expression in transfected 293T cell line by PSME3 polyclonal antibody. Lane 1: PSME3 transfected lysate(28.05 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: PA28 Activator gamma Subunit/PSME3 Antibody [H00010197-B01P] - Analysis of purified antibody to PSME3 on HeLa cell. (antibody concentration 30 ug/ml)

Product Discontinued

PA28 Activator gamma Subunit/PSME3 Antibody Summary

• Immunogen: PSME3 (AAH01423.1, 1 a.a. - 254 a.a.) full-length human protein. MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDVNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PSME3
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is useful for Western Blot, Functional

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PA28 Activator gamma Subunit/PSME3 Antibody

• 11S regulator complex gamma subunit
• 11S regulator complex subunit gamma
• Activator of multicatalytic protease subunit 3
• Ki antigen
• Ki
• PA28 Activator gamma Subunit
• PA28g
• PA28gamma
• PA28-gamma
• PA28GKi nuclear autoantigen
• proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki)
• Proteasome activator 28 subunit gamma
• proteasome activator 28-gamma
• proteasome activator complex subunit 3
• PSME3
• REG gamma
• REG-gamma

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Two transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSME3
• Uniprot:
  • AAH01423.1(Human)