p67phox/NOXA2 Antibody (7J7N3)

Western Blot: p67phox/NOXA2 Antibody (7J7N3) [NBP3-16257] - Western blot analysis of extracts of various cell lines, using p67phox/NOXA2 Rabbit mAb (NBP3-16257) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunohistochemistry-Paraffin: p67phox/NOXA2 Antibody (7J7N3) [NBP3-16257] - Immunohistochemistry of paraffin-embedded mouse kidney using p67phox/NOXA2 Rabbit mAb (NBP3-16257) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 7J7N3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

p67phox/NOXA2 Antibody (7J7N3) Summary

• Description: Novus Biologicals Rabbit p67phox/NOXA2 Antibody (7J7N3) (NBP3-16257) is a recombinant monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human p67phox/NOXA2 (P19878). GKATVVASVVDQDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVELR
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: NCF2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 60 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for p67phox/NOXA2 Antibody (7J7N3)

• autosomal 2
• NADPH oxidase activator 2
• NCF2
• NCF-2
• neutrophil cytosol factor 2
• neutrophil cytosolic factor 2 (65kD, chronic granulomatous disease, autosomal2)
• neutrophil cytosolic factor 2
• NOXA2
• NOXA2FLJ93058
• p67phox
• p67-phox

Background

NOXA2 encodes neutrophil cytosolic factor 2, the 67-kilodalton cytosolic subunit of the multi-protein NADPH oxidase complex found in neutrophils. This oxidase produces a burst of superoxide which is delivered to the lumen of the neutrophil phagosome. Mutations in this gene, as well as in other NADPH oxidase subunits, can result in chronic granulomatous disease, a disease that causes recurrent infections by catalase-positive organisms. Alternative splicing results in two transcript variants that encode the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NCF2