p66 alpha Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

p66 alpha Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GATAD2A.
  
  

  Source: E. coli

  Amino Acid Sequence: RRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GATAD2A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87359.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for p66 alpha Recombinant Protein Antigen

• FLJ20085
• FLJ21017
• GATA zinc finger domain containing 2A
• GATA zinc finger domain-containing protein 2A
• hp66alpha
• p66 alpha
• p66alpha
• transcriptional repressor p66-alpha

Background

Methylation of cytosine at CpG dinucleotides is a common feature of many higher eukaryotic genomes (1-3). Increasing evidence indicates that recruitement of histone deacetylase complexes by methyl-CpG-binding proteins (MeCP) is a major mechanism of methylated DNA silencing. P66, a zinc finger-containing protein is one of the components of the MeCP1 complex (4). P66 and p68, the two components of MeCP1 are different forms of the same zinc finger-containing protein and are conserved from C.elegans to humans. Homologs of p66 from different organisms revealed two highly conserved regions, CR1 and CR2. While CR1 is involved in the association of p66 with other MeCP1 components, CR2 plays an important role in targeting p66 and MBD3 to specific loci (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GATAD2A