p66 alpha Recombinant Protein Antigen

Images

 
There are currently no images for p66 alpha Protein (NBP1-87359PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

p66 alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GATAD2A.

Source: E. coli

Amino Acid Sequence: RRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GATAD2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87359.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for p66 alpha Recombinant Protein Antigen

  • FLJ20085
  • FLJ21017
  • GATA zinc finger domain containing 2A
  • GATA zinc finger domain-containing protein 2A
  • hp66alpha
  • p66 alpha
  • p66alpha
  • transcriptional repressor p66-alpha

Background

Methylation of cytosine at CpG dinucleotides is a common feature of many higher eukaryotic genomes (1-3). Increasing evidence indicates that recruitement of histone deacetylase complexes by methyl-CpG-binding proteins (MeCP) is a major mechanism of methylated DNA silencing. P66, a zinc finger-containing protein is one of the components of the MeCP1 complex (4). P66 and p68, the two components of MeCP1 are different forms of the same zinc finger-containing protein and are conserved from C.elegans to humans. Homologs of p66 from different organisms revealed two highly conserved regions, CR1 and CR2. While CR1 is involved in the association of p66 with other MeCP1 components, CR2 plays an important role in targeting p66 and MBD3 to specific loci (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87358
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, KD, WB
NB100-81657
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
H00010714-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-92242
Species: Hu, Mu, Rt
Applications: WB
NBP3-16718
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP1-93469
Species: Hu
Applications: IHC,  IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
NB300-812
Species: Hu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB500-123
Species: Hu, Mu
Applications: B/N, ChIP, Func, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-27151
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-13734
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF3184
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NBP2-32901
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for p66 alpha Protein (NBP1-87359PEP) (0)

There are no publications for p66 alpha Protein (NBP1-87359PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p66 alpha Protein (NBP1-87359PEP) (0)

There are no reviews for p66 alpha Protein (NBP1-87359PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for p66 alpha Protein (NBP1-87359PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p66 alpha Products

Blogs on p66 alpha

There are no specific blogs for p66 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our p66 alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GATAD2A