Recombinant Human p53R2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human p53R2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 3 - 84 of Human RRM2B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKAD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RRM2B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human p53R2 Protein

  • EC 1.17.4.1
  • MGC102856
  • MGC42116
  • MTDPS8A
  • MTDPS8B
  • p53-inducible ribonucleotide reductase small subunit 2 homolog
  • p53-inducible ribonucleotide reductase small subunit 2-like protein
  • p53R2
  • P53R2DKFZp686M05248
  • PEOA5
  • ribonucleoside-diphosphate reductase subunit M2 B
  • ribonucleotide reductase M2 B (TP53 inducible)
  • RRM2B
  • TP53-inducible ribonucleotide reductase M2 B

Background

RRM2B - ribonucleotide reductase M2 B (TP53 inducible)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90814
Species: Hu
Applications: IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
NBP2-46198
Species: Hu
Applications: WB, IHC
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84256
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92505
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-52097
Species: Hu
Applications: WB, IHC, PEP-ELISA
H00050484-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for p53R2 Partial Recombinant Protein (H00050484-Q01) (0)

There are no publications for p53R2 Partial Recombinant Protein (H00050484-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p53R2 Partial Recombinant Protein (H00050484-Q01) (0)

There are no reviews for p53R2 Partial Recombinant Protein (H00050484-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p53R2 Partial Recombinant Protein (H00050484-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p53R2 Products

Bioinformatics Tool for p53R2 Partial Recombinant Protein (H00050484-Q01)

Discover related pathways, diseases and genes to p53R2 Partial Recombinant Protein (H00050484-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p53R2 Partial Recombinant Protein (H00050484-Q01)

Discover more about diseases related to p53R2 Partial Recombinant Protein (H00050484-Q01).
 

Pathways for p53R2 Partial Recombinant Protein (H00050484-Q01)

View related products by pathway.

PTMs for p53R2 Partial Recombinant Protein (H00050484-Q01)

Learn more about PTMs related to p53R2 Partial Recombinant Protein (H00050484-Q01).
 

Research Areas for p53R2 Partial Recombinant Protein (H00050484-Q01)

Find related products by research area.

Blogs on p53R2

There are no specific blogs for p53R2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
p53R2 Antibody
NBP1-76781

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human p53R2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RRM2B
Entrez