P311 Recombinant Protein Antigen

Images

 
There are currently no images for P311 Protein (NBP1-84315PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

P311 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NREP.

Source: E. coli

Amino Acid Sequence: YYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NREP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84315.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for P311 Recombinant Protein Antigen

  • chromosome 5 open reading frame 13
  • neuronal protein 3.1
  • P311PTZ17D4S114
  • PRO1873
  • Protein p311

Background

C5orf13 may have roles in neural function. Ectopic expression augments motility of gliomas. Promotes also axonal regeneration . May also have functions in cellular differentiation . Induces differentiation of fibroblast into myofibroblast and myofibroblast ameboi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7754-BH/CF
Species: Hu
Applications: BA
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-13954
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DMP900
Species: Hu
Applications: ELISA
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
H00055835-M02
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP1-86658
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00000053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP1-04266
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB38352
Species: Hu, Mu
Applications: ICC, WB
DVE00
Species: Hu
Applications: ELISA
NB600-507
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, PEP-ELISA, WB
NBP1-36955
Species: Hu, Mu
Applications: PEP-ELISA, WB
233-FB
Species: Hu
Applications: BA
NBP1-92685
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, KO, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-84315PEP
Species: Hu
Applications: AC

Publications for P311 Protein (NBP1-84315PEP) (0)

There are no publications for P311 Protein (NBP1-84315PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P311 Protein (NBP1-84315PEP) (0)

There are no reviews for P311 Protein (NBP1-84315PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for P311 Protein (NBP1-84315PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional P311 Products

Array NBP1-84315PEP

Bioinformatics Tool for P311 Protein (NBP1-84315PEP)

Discover related pathways, diseases and genes to P311 Protein (NBP1-84315PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P311 Protein (NBP1-84315PEP)

Discover more about diseases related to P311 Protein (NBP1-84315PEP).
 

Pathways for P311 Protein (NBP1-84315PEP)

View related products by pathway.

PTMs for P311 Protein (NBP1-84315PEP)

Learn more about PTMs related to P311 Protein (NBP1-84315PEP).
 

Research Areas for P311 Protein (NBP1-84315PEP)

Find related products by research area.

Blogs on P311

There are no specific blogs for P311, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our P311 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NREP