p190RhoGAP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: p190RhoGAP Antibody [NBP2-49229] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies & aggresome. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49229] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49229] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.

Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49229] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49229] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

p190RhoGAP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit p190RhoGAP Antibody - BSA Free (NBP2-49229) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VNVDLAFSTLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKNHNENWLSVSRKMQASPEYQDYVYLEGTQKAKKLF
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGAP35
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  p190RhoGAP Recombinant Protein Antigen (NBP2-49229PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for p190RhoGAP Antibody - BSA Free

• glucocorticoid receptor DNA binding factor 1
• glucocorticoid receptor DNA-binding factor 1
• glucocorticoid receptor repression factor 1
• GRF1
• GRF-1
• GRLF1
• KIAA1722
• MGC10745
• P190A
• P190-A
• p190ARhoGAP
• p190RhoGAP
• rho GAP p190A
• Rho GTPase activating protein 35
• rho GTPase-activating protein 35

Background

The human glucocorticoid receptor DNA binding factor, which associates with the promoter region of the glucocorticoid receptor gene (hGR gene), is a repressor of glucocorticoid receptor transcription. The amino acid sequence deduced from the cDNA sequences show the presence of three sequence motifs characteristic of a zinc finger and one motif suggestive of a leucine zipper in which 1 cysteine is found instead of all leucines. The GRLF1 enhances the homologous down-regulation of wild-type hGR gene expression. Biochemical analysis suggests that GRLF1 interaction is sequence specific and that transcriptional efficacy of GRLF1 is regulated through its interaction with specific sequence motif. The level of expression is regulated by glucocorticoids. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGAP35