p16INK4a/CDKN2A Antibody (0D0C8) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 57-156 of human p16INK4a/CDKN2A (P42771). ARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
CDKN2A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL.
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Knockout Validated
- Western Blot 1:1000 - 1:5000
|
| Theoretical MW |
17 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for p16INK4a/CDKN2A Antibody (0D0C8)
Background
CDKN2A/p16INK4a is a gene that codes for a widely expressed protein with four isoforms, measuring 156, 105, 116, and 167 amino acids in length with weights of approximately 17, 11, 12, and 18 kDa respectively. CDKN2A/p16INK4a functions as a negative regulator of the proliferation of cells, which then allows them to interact with cyclins D and to phosphorylate the retinoblastoma protein. Current studies are being done on several diseases and disorders related to this gene including Li-Fraumeni syndrome, malignant peripheral nerve sheath tumor, blastic plasmacytoid dendritic cell, acth-secreting pituitary adenoma, recessive dystrophic epidermolysis bullosa, marginal zone b-cell lymphoma, adult astrocytic tumor, melanoma, and squamous cell carcinoma. CDKN2A/p16INK4a has also been shown to have interactions with MDM2, ZNF420, EGR1, MYCN, and CDK6 in pathways such as the cell cycle, p53 signaling, mitochondrial apoptosis, HIF-1 Alpha, CRHR, pancreatic cancer, and glioma pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: WB, ELISA, ICC/IF, KO
Publications for p16INK4a/CDKN2A Antibody (NBP3-15420) (0)
There are no publications for p16INK4a/CDKN2A Antibody (NBP3-15420).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for p16INK4a/CDKN2A Antibody (NBP3-15420) (0)
There are no reviews for p16INK4a/CDKN2A Antibody (NBP3-15420).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for p16INK4a/CDKN2A Antibody (NBP3-15420) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional p16INK4a/CDKN2A Products
Research Areas for p16INK4a/CDKN2A Antibody (NBP3-15420)
Find related products by research area.
|
Blogs on p16INK4a/CDKN2A