p15INK4b/CDKN2B Antibody - Azide and BSA Free

Western Blot: p15INK4b/CDKN2B Antibody [H00001030-B02P] - Analysis of CDKN2B expression in transfected 293T cell line by CDKN2B polyclonal antibody. Lane 1: CDKN2B transfected lysate(15.29 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

p15INK4b/CDKN2B Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CDKN2B (AAH14469, 1 a.a. - 138 a.a.) full-length human protein. MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CDKN2B
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot
• Application Notes: This antibody is useful for WB. IHC usage was reported in scientific literature.

Reactivity Notes

Mouse reported in scientific literature (PMID: 20945347).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p15INK4b/CDKN2B Antibody - Azide and BSA Free

• CDK4I
• CDKN2B
• cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
• cyclin-dependent kinases 4 and 6 binding protein
• INK4BCDK4B inhibitor
• MTS2
• MTS-2
• MTS2CDK inhibitory protein
• Multiple tumor suppressor 2
• p14_CDK inhibitor
• p14_INK4B
• p14-INK4b
• p15 CDK inhibitor
• p15_INK4B
• P15cyclin-dependent kinase 4 inhibitor B
• p15INK4b
• p15-INK4b
• TP15

Background

This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for p15INK4b/CDKN2B Antibody (H00001030-B02P)(1)

Publication using H00001030-B02P

• Iordanskaia T, Nawshad A. Mechanisms of transforming growth factor beta induced cell cycle arrest in palate development J Cell Physiol 2011-05-01 [PMID: 20945347] (WB, IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: CDKN2B
• Uniprot:
  • AAH14469(Human)