OXTR Antibody - BSA Free

Western Blot: OXTR Antibody [NBP3-35886] - Western blot analysis of various lysates using OXTR Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OXTR Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit OXTR Antibody - BSA Free (NBP3-35886) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-394 of human OXTR (NP_000907.2).
  
  Sequence:
  WDANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGETSASKKSNSSSFVLSHRSSSQRSCSQPSTA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OXTR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 43 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for OXTR Antibody - BSA Free

• OT-R
• OXTR
• oxytocin receptor

Background

The protein encoded by the Oxytocin Receptor gene belongs to the G-protein coupled receptor family and acts as a receptor for oxytocin. Its activity is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. The oxytocin-oxytocin receptor system plays an important role in the uterus during parturition. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OXTR