OXR1 Antibody - BSA Free

Immunohistochemistry-Paraffin: OXR1 Antibody [NBP1-86393] - Analysis in human cerebral cortex and pancreas tissues. Corresponding OXR1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: OXR1 Antibody [NBP1-86393] - Staining of human cerebral cortex, fallopian tube, pancreas and testis using Anti-OXR1 antibody NBP1-86393 (A) shows similar protein distribution across tissues to independent antibody NBP1-86392 (B).

Immunohistochemistry-Paraffin: OXR1 Antibody [NBP1-86393] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: OXR1 Antibody [NBP1-86393] - Staining of human cerebral cortex shows strong positivity in neuropil.

Immunohistochemistry-Paraffin: OXR1 Antibody [NBP1-86393] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: OXR1 Antibody [NBP1-86393] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and OXR1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OXR1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QDSFLHENSLHQEESQKENMPCGETAEFKQKQSVNKGKQGKEQNQDSQTEAEELRKLWKTHTMQQTKQQRENIQQVS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OXR1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 29069806). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  OXR1 Protein (NBP1-86393PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for OXR1 Antibody - BSA Free

• FLJ10125
• FLJ38829
• FLJ40849
• FLJ41673
• FLJ42450
• FLJ45656
• oxidation resistance 1
• oxidation resistance protein 1
• putative protein product of Nbla00307

Background

Oxidation resistance 1 (OXR1) protein was originally identified in a screen for human genes that function to protect cells from oxidative damage. OXR1 localizes to the mitochondria, and its expression has been shown to be induced by heat and oxidative stress.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OXR1 Antibody (NBP1-86393)(2)

Publications using NBP1-86393

• Fievet A, Bellanger D, Zahed L et al. DNA repair functional analyses of NBN hypomorphic variants associated with NBN-related infertility Hum Mutat. 2019-11-15 [PMID: 31729086] (WB, Human)
• Hebert L, Bellanger D, Guillas C et al. Modulating BAP1 expression affects ROS homeostasis, cell motility and mitochondrial function. Oncotarget. 2017-09-22 [PMID: 29069806] (WB, Human)

Bioinformatics

• Gene Symbol: OXR1
• Entrez:
  • 55074(Human)
• Uniprot:
  • Q8N573(Human)