Orexin R2/HCRTR2 Antibody (1E3.)


Western Blot: Orexin R2/HCRTR2 Antibody (1E3) [H00003062-M01] - Analysis of HCRTR2 expression in transfected 293T cell line by HCRTR2 monoclonal antibody (M01), clone 1E3.Lane 1: HCRTR2 transfected lysate(50.7 KDa).Lane ...read more
Western Blot: Orexin R2/HCRTR2 Antibody (1E3) [H00003062-M01] - Analysis of HCRTR2 over-expressed 293 cell line, cotransfected with HCRTR2 Validated Chimera RNAi ( Cat # H00003062-R01V ) (Lane 2) or non-transfected ...read more
Sandwich ELISA: Orexin R2/HCRTR2 Antibody (1E3) [H00003062-M01] - Detection limit for recombinant GST tagged HCRTR2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi

Order Details

Orexin R2/HCRTR2 Antibody (1E3.) Summary

HCRTR2 (NP_001517, 1 a.a. - 54 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYE
Isoform 1 and isoform 4: Cell membrane; single pass type I membrane protein. Isoform 2 and isoform 3: Secreted protein.
HCRTR2 - hypocretin (orexin) receptor 2
IgG1 Kappa
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • RNA Inhibition
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.
Reviewed Applications
Read 1 Review rated 5
H00003062-M01 in the following applications:

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Orexin R2/HCRTR2 Antibody (1E3.)

  • HCRTR2
  • hypocretin (orexin) receptor 2
  • Hypocretin receptor type 2
  • Orexin R2
  • Orexin Receptor 2
  • orexin receptor type 2
  • OrexinR2
  • OX2R
  • Ox-2-R
  • ox2-R


HCRTR2 is a G-protein coupled receptor expressed exclusively in the brain. It has 64% identity with HCRTR1. HCRTR2 binds both orexin A and orexin B neuropeptides. HCRTR2 is involved in the central feedback mechanism that regulates feeding behaviour.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, RNAi

Publications for Orexin R2/HCRTR2 Antibody (H00003062-M01) (0)

There are no publications for Orexin R2/HCRTR2 Antibody (H00003062-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Orexin R2/HCRTR2 Antibody (H00003062-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00003062-M01:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot Orexin R2/HCRTR2 H00003062-M01
reviewed by:
WB Human 06/08/2011


ApplicationWestern Blot
Sample TestedH00003062-Q01 and H00003062-B01, Sample Amount:.01,.025,.05, 0.1, 0.2 ug
CommentsLinear relation for Ox2R monoclonal antibody immuno-recognition of human orexin receptor 2 (Swiss-Prot NP_001517) peptide. Recombinant receptor peptide corresponds to amino acids 1-55 at the N-terminus (MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWRE) tagged with a recombinant glutathione S-transferase (GST) fusion protein with a molecular weight of 35-45 kDa. The amino acid sequence for human orexin receptor 2 sequence is 94% homologous to rat. R squared value, 0.9678. I used the Millipore Snap ID system for blocking, washing and secondary incubations. I listed the secondary antibody dilution as 1:50000 but keep in mind this is 0.25 ug of antibody in 10 ml of blocking buffer. If you are using the Snap ID system then the dilution would be 1:6000 (0.25 ug in 1.5 ml. The transfer system used was BioRad's semi dry at 20 V for 30 min, transfer buffer was BioRad'S TG buffer (20% methanol). Membrane used was PVDF (Thermo Scientific).


Blocking DetailsBuffer: SuperBlock T20 (TBS), proprietary protein formulation in TBS, pH7.4 w/ 0.05% Tween-20 & Kathon, Time/Temp: 3min at 25C

Primary Anitbody

Dilution RatioDilution Ratio: 1:1000, Incubation Dilution Buffer: SuperBlock T20 (TBS), Incubation Time/Temp: overnight at 4C

Secondary Antibody

Secondary DescriptionSecondary Ab: Novus rabbit polyclonal anti-mouse HRP, Secondary Ab Dilution Ratio: 1:50000
Secondary Manufacturer Cat#Novus NB720-H


Detection NotesDetection Method: HRP-West Pico (Thermo Scientific), Exposure Time: 30 seconds, Specific Bands: 35-45 kDa


CommentsLinear relation for Ox2R monoclonal antibody immuno-recognition of human orexin receptor 2 (Swiss-Prot NP_001517) peptide. Recombinant receptor peptide corresponds to amino acids 1-55 at the N-terminus (MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWRE) tagged with a recombinant glutathione S-transferase (GST) fusion protein with a molecular weight of 35-45 kDa. The amino acid sequence for human orexin receptor 2 sequence is 94% homologous to rat. R squared value, 0.9678. I used the Millipore Snap ID system for blocking, washing and secondary incubations. I listed the secondary antibody dilution as 1:50000 but keep in mind this is 0.25 ug of antibody in 10 ml of blocking buffer. If you are using the Snap ID system then the dilution would be 1:6000 (0.25 ug in 1.5 ml. The transfer system used was BioRad's semi dry at 20 V for 30 min, transfer buffer was BioRad'S TG buffer (20% methanol). Membrane used was PVDF (Thermo Scientific).

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Orexin R2/HCRTR2 Antibody (H00003062-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Orexin R2/HCRTR2 Products

Bioinformatics Tool for Orexin R2/HCRTR2 Antibody (H00003062-M01)

Discover related pathways, diseases and genes to Orexin R2/HCRTR2 Antibody (H00003062-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Orexin R2/HCRTR2 Antibody (H00003062-M01)

Discover more about diseases related to Orexin R2/HCRTR2 Antibody (H00003062-M01).

Pathways for Orexin R2/HCRTR2 Antibody (H00003062-M01)

View related products by pathway.

PTMs for Orexin R2/HCRTR2 Antibody (H00003062-M01)

Learn more about PTMs related to Orexin R2/HCRTR2 Antibody (H00003062-M01).

Research Areas for Orexin R2/HCRTR2 Antibody (H00003062-M01)

Find related products by research area.

Blogs on Orexin R2/HCRTR2

There are no specific blogs for Orexin R2/HCRTR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Human


Gene Symbol HCRTR2