OXR1 Antibody

Images

 
Western Blot: OXR1 Antibody [NBP1-86393] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected lysate). Lane 3: Over-expression lysate.
Immunohistochemistry-Paraffin: OXR1 Antibody [NBP1-86393] Staining of human epididymis shows strong positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OXR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QDSFLHENSLHQEESQKENMPCGETAEFKQKQSVNKGKQGKEQNQDSQTEAEELRKLWKTHTMQQTKQQRENIQQVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OXR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OXR1 Protein (NBP1-86393PEP)
Publications
Read Publication using
NBP1-86393 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OXR1 Antibody

  • FLJ10125
  • FLJ38829
  • FLJ40849
  • FLJ41673
  • FLJ42450
  • FLJ45656
  • oxidation resistance 1
  • oxidation resistance protein 1
  • putative protein product of Nbla00307

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB763
Species: Hu, Mu, Rt
Applications: IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-85199
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
H00003062-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
AF2554
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-24715
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P

Publications for OXR1 Antibody (NBP1-86393)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for OXR1 Antibody (NBP1-86393) (0)

There are no reviews for OXR1 Antibody (NBP1-86393). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OXR1 Antibody (NBP1-86393) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OXR1 Products

Bioinformatics Tool for OXR1 Antibody (NBP1-86393)

Discover related pathways, diseases and genes to OXR1 Antibody (NBP1-86393). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OXR1 Antibody (NBP1-86393)

Discover more about diseases related to OXR1 Antibody (NBP1-86393).
 

Pathways for OXR1 Antibody (NBP1-86393)

View related products by pathway.

PTMs for OXR1 Antibody (NBP1-86393)

Learn more about PTMs related to OXR1 Antibody (NBP1-86393).

Blogs on OXR1

There are no specific blogs for OXR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OXR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OXR1
Entrez
Uniprot