Recombinant Mouse OX40 Ligand/TNFSF4 Protein

Images

 
In vitro assay: TNFSF4 Protein [NBP2-26577] - Demonstration in vitro of the potency of Fc-OX40L in comparison to an agonist antibody OX86, with anti-CD3 alone serving as a negative control for co-stimulation.
SDS-Page: TNFSF4 Protein [NBP2-26577] - Electrophoretic analysis of Fc-mOX40L using Coomassie blue stained 4-20% reducing SDS-PAGE.
SDS-Page: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577] - Electrophoretic analysis of Fc-mOX40L using Coomassie blue stained 4-15% reducing SDS-PAGE.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications In vitro, PAGE
Concentration
2 mg/ml

Order Details

Recombinant Mouse OX40 Ligand/TNFSF4 Protein Summary

Description
A recombinant protein corresponding to TNFSF4.

Amino Acid Sequence:
EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKSGRQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL Mouse Ig-Fc amino acid sequence, followed by linker (SGR) in bold and Extracellular mouse OX40L amino acid sequence is underlined

Details of Functionality
In vitro proliferation assay, in vivo assays.This protein was measured by its ability to co-stimulate IL-2 secretion in the presence of anti-mCD3, and agonist antibody OX86.
Protein/Peptide Type
Recombinant Protein
Gene
TNFSF4
Purity
Protein A purified
Endotoxin Note
Endotoxin level < 0.1 EU/ug of the protein (< 0.01 ng/ug of the protein) as determined by the LAL test.

Applications/Dilutions

Application Notes
Use in vitro assays and Function reported in scientific literature (PMID 24633226)
Theoretical MW
43.54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP2-26577 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24633226)

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
Phosphate-buffered solution, pH 7.2, containing no preservative. 0.2 um filter sterilized.
Preservative
No Preservative
Concentration
2 mg/ml
Purity
Protein A purified

Alternate Names for Recombinant Mouse OX40 Ligand/TNFSF4 Protein

  • CD134 ligand
  • CD134L
  • CD252 antigen
  • CD252
  • Glycoprotein Gp34
  • gp34
  • OX40 antigen ligand
  • OX40 Ligand
  • OX40L
  • OX-40L
  • OX4OL
  • TAX transcriptionally-activated glycoprotein 1
  • tax-transcriptionally activated glycoprotein 1 (34kD)
  • tax-transcriptionally activated glycoprotein 1, 34kD
  • TNFSF4
  • tumor necrosis factor (ligand) superfamily, member 4
  • tumor necrosis factor ligand superfamily member 4
  • TXGP1

Background

OX40 (CD134) and its natural ligand OX40L (CD134L) belong to the tumor necrosis factor superfamily. OX40L is primarily expressed on antigen presenting cells including activated B-cells, dendritic cells, and macrophages. OX40L has been shown to be expressed on activated endothelial cells and CD4+ T-cells during antigen stimulation. OX-40 and OX-40L interactions are crucial for the generation and survival of memory CD4+ T-cells. These interactions may stimulate effector and memory CD4+ and CD8+ T-cells and suppress CD4+/CD25+ Tregs and may have a role in enhanced immune response.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-62202
Species: Hu, Mk
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF382
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, Neut
6507-IL/CF
Species: Hu
AF1246
Species: Mu
Applications: WB
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1028
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB2738
Species: Hu
Applications: WB, ICC
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-64358
Species: Hu
Applications: Flow, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-26577
Species: Mu
Applications: In vitro, PAGE
Supplier Logo

Publications for OX40 Ligand/TNFSF4 Recombinant Protein (NBP2-26577)(2)

Reviews for OX40 Ligand/TNFSF4 Recombinant Protein (NBP2-26577) (0)

There are no reviews for OX40 Ligand/TNFSF4 Recombinant Protein (NBP2-26577). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for OX40 Ligand/TNFSF4 Recombinant Protein (NBP2-26577). (Showing 1 - 1 of 1 FAQs).

  1. Could you let me know the expression cell of this recombinant protein?
    • The actual cell line(s) that was used is considered a proprietary information, and therefore could be be revealed.

Additional OX40 Ligand/TNFSF4 Products

Bioinformatics Tool for OX40 Ligand/TNFSF4 Recombinant Protein (NBP2-26577)

Discover related pathways, diseases and genes to OX40 Ligand/TNFSF4 Recombinant Protein (NBP2-26577). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OX40 Ligand/TNFSF4 Recombinant Protein (NBP2-26577)

Discover more about diseases related to OX40 Ligand/TNFSF4 Recombinant Protein (NBP2-26577).
 

Pathways for OX40 Ligand/TNFSF4 Recombinant Protein (NBP2-26577)

View related products by pathway.

PTMs for OX40 Ligand/TNFSF4 Recombinant Protein (NBP2-26577)

Learn more about PTMs related to OX40 Ligand/TNFSF4 Recombinant Protein (NBP2-26577).
 

Research Areas for OX40 Ligand/TNFSF4 Recombinant Protein (NBP2-26577)

Find related products by research area.

Blogs on OX40 Ligand/TNFSF4

There are no specific blogs for OX40 Ligand/TNFSF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Mouse OX40 Ligand/TNFSF4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFSF4