Recombinant Human Osteocalcin Protein

Images

 
SDS-Page: Osteocalcin Recombinant Protein [H00000632-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Func, PA

Order Details

Recombinant Human Osteocalcin Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human BGLAP full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV

Protein/Peptide Type
Recombinant Protein
Gene
BGLAP

Applications/Dilutions

Application Notes
Use in function reported in scientific literature (PMID 21425331)
Publications
Read Publications using H00000632-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Osteocalcin Protein

  • BGLAP
  • BGP
  • bone gamma-carboxyglutamate (gla) protein (osteocalcin)
  • bone gamma-carboxyglutamate (gla) protein
  • Bone Gla protein
  • Gamma-carboxyglutamic acid-containing protein
  • OC
  • OCN
  • Osteocalcin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
AF6146
Species: Hu
Applications: ICC
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000632-P01
Species: Hu
Applications: WB, ELISA, Func, PA

Publications for Osteocalcin Recombinant Protein (H00000632-P01)(2)

We have publications tested in 1 application: Func.


Filter By Application
Func
(1)
All Applications
Filter By Species
All Species

Reviews for Osteocalcin Recombinant Protein (H00000632-P01) (0)

There are no reviews for Osteocalcin Recombinant Protein (H00000632-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Osteocalcin Recombinant Protein (H00000632-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Osteocalcin Products

Bioinformatics Tool for Osteocalcin Recombinant Protein (H00000632-P01)

Discover related pathways, diseases and genes to Osteocalcin Recombinant Protein (H00000632-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Osteocalcin Recombinant Protein (H00000632-P01)

Discover more about diseases related to Osteocalcin Recombinant Protein (H00000632-P01).
 

Pathways for Osteocalcin Recombinant Protein (H00000632-P01)

View related products by pathway.

PTMs for Osteocalcin Recombinant Protein (H00000632-P01)

Learn more about PTMs related to Osteocalcin Recombinant Protein (H00000632-P01).
 

Research Areas for Osteocalcin Recombinant Protein (H00000632-P01)

Find related products by research area.

Blogs on Osteocalcin

There are no specific blogs for Osteocalcin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-2 [Unconjugated]
355-BM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Osteocalcin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BGLAP
Entrez