Osteocalcin Antibody (2D5)

Sandwich ELISA: Osteocalcin Antibody (2D5) [H00000632-M02] - Detection limit for recombinant GST tagged BGLAP is 0.1 ng/ml as a capture antibody.

Product Discontinued

Osteocalcin Antibody (2D5) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: BGLAP (NP_954642, 52 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
• Isotype: IgG1 Lambda
• Clonality: Monoclonal
• Host: Mouse
• Gene: BGLAP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: It has been used for ELISA and WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Osteocalcin Antibody (2D5)

• BGLAP
• BGP
• bone gamma-carboxyglutamate (gla) protein (osteocalcin)
• bone gamma-carboxyglutamate (gla) protein
• Bone Gla protein
• Gamma-carboxyglutamic acid-containing protein
• OC
• OCN
• Osteocalcin

Background

Osteocalcin belongs to the osteocalcin/matrix Gla protein family and constitutes 1 to 2% of the total bone protein. It is a 49 amino acid single chain vitamin K dependent protein, made by osteoblasts, and is a major component of the noncollagenous bone matrix. Post translational modification by a vitamin K dependent carboxylase produces three gamma carboxyglutamic acid residues at positions 17, 21 and 24, giving it a high affinity for calcium. It also binds strongly to apatite. Sixty to ninety percent of de novo synthesized osteocalcin is incorporated into the bone matrix where it binds to hydroxyapatite during matrix mineralization. The remainder of the osteocalcin is released into the circulation where it can be measured as a sensitive marker of bone formation. Osteocalcin found in serum is almost exclusively derived from the bone formation with little or no contribution from the resorption process. Drugs acting primarily on bone resorption, such as bisphosphonates, induce a rapid decline in specific bone resorption markers, whereas osteocalcin levels only change after extended therapy periods, in accordance with the expected dynamics of a bone formation marker. Serum osteocalcin is elevated in diseases characterized by increased bone turnover such as osteoporosis, hyperparathyroidism and Paget's disease, and low in conditions associated with low bone turnover such as hypoparathyroidism and growth hormone deficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BGLAP
• Uniprot:
  • NP_954642(Human)