ORP1 Antibody - BSA Free

Western Blot: ORP1 Antibody [NBP3-10055] - Western blot analysis of ORP1 in Human Mesenchymoma Tumor lysates. Antibody dilution at 1ug/ml

Product Discontinued

ORP1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ORP1 (NP_001229437.1). Peptide sequence LYGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPVPD
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OSBPL1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 568 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ORP1 Antibody - BSA Free

• FLJ10217
• ORP-1oxysterol-binding protein-related protein 1 variant 1
• ORP1oxysterol-binding protein-related protein 1
• OSBP8
• OSBPL1
• OSBPL1B
• OSBP-related protein 1
• oxysterol binding protein-like 1A
• oxysterol binding protein-like 1B
• oxysterol-binding protein-related protein 1 variant 2

Background

Oxysterols are oxygenated derivatives of cholesterol that have a number of biological effects and play a key role in the maintenance of the body cholesterol balance. ORP1 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors that are believed to transport sterols from lysosomes to the nucleus where the sterol down-regulates the genes for the LDL receptor, HMG-CoA reductase, and HMG synthetase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OSBPL1A