ORC4L Antibody

Western Blot: ORC4L Antibody [H00005000-B01P] - Analysis of ORC4L expression in Jurkat.

Immunocytochemistry/Immunofluorescence: ORC4L Antibody [H00005000-B01P] - Analysis of purified antibody to ORC4L on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: ORC4L Antibody [H00005000-B01P] - Analysis of ORC4L expression in transfected 293T cell line by ORC4L polyclonal antibody. Lane 1: ORC4L transfected lysate(47.96 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

ORC4L Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: ORC4L (NP_002543.2, 1 a.a. - 436 a.a.) full-length human protein. MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPNCPTDVRQWATSSLSWL
• Specificity: This product is specific for Human ORC4L purified MaxPab mouse polyclonal antibody (B01P) [Gene ID: 5000].
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ORC4
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ORC4L Antibody

• HsORC4
• ORC4LFLJ46668
• ORC4P
• origin recognition complex subunit 4
• origin recognition complex, subunit 4 (yeast homolog)-like
• origin recognition complex, subunit 4 homolog (S. cerevisiae)
• origin recognition complex, subunit 4 homolog
• origin recognition complex, subunit 4
• origin recognition complex, subunit 4-like (S. cerevisiae)
• origin recognition complex, subunit 4-like (yeast)
• origin recognition complex, subunit 4-like

Background

The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. It has been shown to form a core complex with ORC2L, -3L, and -5L. Three alternatively spliced transcript variants encoding the same protein have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ORC4
• Uniprot:
  • NP_002543.2(Human)