Recombinant Human OR11A1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human OR11A1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-315 of Human OR11A1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEIVSTGNETITEFVLLGFYDIPELHFLFFIVFTAVYVFIIIGNMLIIVAVVSSQRLHKPMYIFLANLSFLDILYTSAVMPKMLEGFLQEATISVAGCLLQFFIFGSLATAECLLLAVMAYDRYLAICYPLHYPLLMGPRRYMGLVVTTWLSGFVVDGLVVALVAQLRFCGPNHIDQFYCDFMLFVGLACSDPRVAQVTTLILSVFCLTIPFGLILTSYARIVVAVLRVPAGASRRRAFSTCSSHLAVVTTFYGTLMIFYVAPSAVHSQLLSKVFSLLYTVVTPLFNPVIYTMRNKEVHQALRKILCIKQTETLD

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
OR11A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
61.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OR11A1 Protein

  • dJ994E9.6
  • family 11, subfamily A, member 2
  • Hs6M1-18
  • olfactory receptor 11A1
  • Olfactory receptor 11A2
  • Olfactory receptor OR6-30
  • olfactory receptor, family 11, subfamily A, member 1
  • OR11A2

Background

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86930
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-356
Species: Hu, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, B/N
NBP1-76639
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
AF5510
Species: Hu
Applications: WB
NBP2-64664
Species: Hu
NBP2-01828
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32530
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46587
Species: Hu
Applications: WB, IHC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-69053
Species: Hu
Applications: WB
8146-GD/CF
Species: Hu
NBP1-76638
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-85935
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-92418
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00056603-M01
Species: Hu
Applications: WB, ELISA
H00026531-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for OR11A1 Recombinant Protein (H00026531-P01) (0)

There are no publications for OR11A1 Recombinant Protein (H00026531-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR11A1 Recombinant Protein (H00026531-P01) (0)

There are no reviews for OR11A1 Recombinant Protein (H00026531-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OR11A1 Recombinant Protein (H00026531-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for OR11A1 Recombinant Protein (H00026531-P01)

Discover related pathways, diseases and genes to OR11A1 Recombinant Protein (H00026531-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for OR11A1 Recombinant Protein (H00026531-P01)

View related products by pathway.

Blogs on OR11A1

There are no specific blogs for OR11A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GDF-15 [Unconjugated]
8146-GD-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OR11A1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OR11A1