OR2H1 Antibody

Images

 
Western Blot: OR2H1 Antibody [NBP1-69053] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OR2H1 Antibody Summary

Immunogen
Synthetic peptides corresponding to OR2H1 (olfactory receptor, family 2, subfamily H, member 1) The peptide sequence was selected from the C terminal of OR2H1. Peptide sequence IAVYLQPKNPYAQGRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALRRLL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OR2H1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against OR2H1 and was validated on Western blot.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OR2H1 Antibody

  • family 2, subfamily H, member 6
  • Hs6M1-16
  • Olfactory receptor 2H6
  • olfactory receptor, family 2, subfamily H, member 1,6M1-16
  • olfactory receptor, family 2, subfamily H, member 8
  • OLFR42A-9004-14
  • OR2H8
  • OR6-2HS6M1-16

Background

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07526
Species: Hu
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP1-43123
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, CyTOF-ready
NBP1-59537
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-98301
Species: Hu
Applications: WB
AF8408
Species: Hu
Applications: WB
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP2-07407
Species: Hu
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NBP2-14715
Species: Hu
Applications: IHC, IHC-P
NBP2-02864
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002550-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP

Publications for OR2H1 Antibody (NBP1-69053) (0)

There are no publications for OR2H1 Antibody (NBP1-69053).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR2H1 Antibody (NBP1-69053) (0)

There are no reviews for OR2H1 Antibody (NBP1-69053). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OR2H1 Antibody (NBP1-69053) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OR2H1 Products

Bioinformatics Tool for OR2H1 Antibody (NBP1-69053)

Discover related pathways, diseases and genes to OR2H1 Antibody (NBP1-69053). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OR2H1 Antibody (NBP1-69053)

Discover more about diseases related to OR2H1 Antibody (NBP1-69053).

PTMs for OR2H1 Antibody (NBP1-69053)

Learn more about PTMs related to OR2H1 Antibody (NBP1-69053).

Blogs on OR2H1

There are no specific blogs for OR2H1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OR2H1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OR2H1
Uniprot