![Western Blot: OPHN1 Antibody [NBP2-85423] - Host: Rabbit. Target Name: OPHN1. Sample Tissue: Human THP-1 Whole Cell lysates. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/OPHN1-Antibody-Western-Blot-NBP2-85423-img0001.jpg "Western Blot: OPHN1 Antibody [NBP2-85423] - Host: Rabbit. Target Name: OPHN1. Sample Tissue: Human THP-1 Whole Cell lysates. Antibody Dilution: 1ug/ml")
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human OPHN1. Peptide sequence: NASDLLIKPLENFRKEQIGFTKERKKKFEKDGERFYSLLDRHLHLSSKKK The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | OPHN1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
![Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunocytochemistry__Immunofluorescence_23325.jpg)
![Neutralization Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Block_Neutralize_8975.jpg)
![Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunohistochemistry_9333.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for OPHN1 Antibody (NBP2-85423)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | OPHN1 |
![Western Blot Ephrin-B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphrinB1_AF473_Western_Blot_17536.jpg)
![Immunohistochemistry Ephrin-B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ephrin-B1_AF473_Immunohistochemistry_7180.jpg)
![Simple Western Ephrin-B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphrinB1_AF473_Simple_Western_18962.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
