| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 851-960 of Human OPA1 Source: Wheat Germ (in vitro) Amino Acid Sequence: NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | OPA1 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Immunocytochemistry Prohibitin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prohibitin_AF3470_Immunocytochemistry__Immunofluorescence_20123.jpg)
Research Areas for OPA1 Partial Recombinant Protein (H00004976-Q01)Find related products by research area.
|
|
Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease By Jamshed Arslan Pharm.D. Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy... Read full blog post. |
|
BNIP3 - a regulator of mitochondrial autophagy and cell death Bcl-2 nineteen-kilodalton interacting protein 3 (BNIP3) is a pro-apoptotic BH3-only protein. BNIP3 localizes to the mitochondrial membrane where it plays a key role in mitochondrial autophagy and cell death pathways. Similar to other Bcl-2 family m... Read full blog post. |
|
Understanding OPA1 and Mitochondrial Function OPA1 belongs to the Dynamin large GTPase protein family. OPA1 exists as a single-pass membrane protein localized in the mitochondrial inner membrane and also as a soluble form in the mitochondrial intermembrane space. There, it is a key player in fusi... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | OPA1 |
![Western Blot: OPA1 Antibody [NB110-55290] - Depletion of Oma1 in fish affects development. Immunoblot of protein extracts from injected fish (yolk removed) at 24, 48 and 72 hpf. Expression of Oma1, Opa1 isoforms (a-f) and Cox4 (mitochondrial abundance marker) was analyzed with respective antibodies. Actin and Ponceau S staining were loading controls. Source data (full-length blots) are available online in Supplementary information. Image collected and cropped by CiteAb from the following publication (https://www.nature.com/articles/srep13989), licensed under a CC-BY license.](https://images.novusbio.com/images/OPA1-Antibody-Western-Blot-NB110-55290-img0010.jpg "Western Blot: OPA1 Antibody [NB110-55290] - Depletion of Oma1 in fish affects development. Immunoblot of protein extracts from injected fish (yolk removed) at 24, 48 and 72 hpf. Expression of Oma1, Opa1 isoforms (a-f) and Cox4 (mitochondrial abundance marker) was analyzed with respective antibodies. Actin and Ponceau S staining were loading controls. Source data (full-length blots) are available online in Supplementary information. Image collected and cropped by CiteAb from the following publication (https://www.nature.com/articles/srep13989), licensed under a CC-BY license.")