We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human OPA1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human OPA1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 851-960 of Human OPA1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
OPA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OPA1 GST (N-Term) Protein

  • BERHS
  • EC 3.6.5.5
  • FLJ12460
  • KIAA0567dynamin-like 120 kDa protein, mitochondrial
  • LargeG
  • lilr3
  • MGM1
  • mitochondrial dynamin-like GTPase
  • MTDPS14
  • NPG
  • NPGlargeG
  • NTG
  • NTGmitochondrial dynamin-like 120 kDa protein
  • OPA1
  • optic atrophy 1 (autosomal dominant)
  • Optic atrophy protein 1

Background

OPA1 - optic atrophy 1 (autosomal dominant)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-55288
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
H00009927-M03
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, RNAi, WB
NBP1-71775
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP3-47447
Species: Hu, Rt
Applications: ELISA, IHC, WB
NBP2-16148
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02477
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-76651
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-85664
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-80878
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92221
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-52300
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC,  IHC-P, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr,  IHC-P, WB
NBP2-01860
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for OPA1 Partial Recombinant Protein (H00004976-Q01) (0)

There are no publications for OPA1 Partial Recombinant Protein (H00004976-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OPA1 Partial Recombinant Protein (H00004976-Q01) (0)

There are no reviews for OPA1 Partial Recombinant Protein (H00004976-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OPA1 Partial Recombinant Protein (H00004976-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OPA1 Products

Research Areas for OPA1 Partial Recombinant Protein (H00004976-Q01)

Find related products by research area.

Blogs on OPA1.

Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
 By Jamshed Arslan Pharm.D.  Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy...  Read full blog post.

BNIP3 - a regulator of mitochondrial autophagy and cell death
Bcl-2 nineteen-kilodalton interacting protein 3 (BNIP3) is a pro-apoptotic BH3-only protein. BNIP3 localizes to the mitochondrial membrane where it plays a key role in mitochondrial autophagy and cell death pathways. Similar to other Bcl-2 family m...  Read full blog post.

Understanding OPA1 and Mitochondrial Function
OPA1 belongs to the Dynamin large GTPase protein family. OPA1 exists as a single-pass membrane protein localized in the mitochondrial inner membrane and also as a soluble form in the mitochondrial intermembrane space. There, it is a key player in fusi...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OPA1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OPA1