OMA1 Recombinant Protein Antigen

Images

 
There are currently no images for OMA1 Protein (NBP2-30971PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

OMA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OMA1.

Source: E. coli

Amino Acid Sequence: YLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OMA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30971.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for OMA1 Recombinant Protein Antigen

  • 2010001O09Rik
  • DAB1
  • EC 3.4.24.-
  • metalloprotease related protein 1
  • Metalloprotease-related protein 1
  • MPRP1
  • MPRP-1mitochondrial
  • OMA1 homolog, zinc metallopeptidase (S. cerevisiae)
  • overlapping activity with M-AAA protease
  • YKR087C
  • ZMPOMA1

Background

OMA1, also known as Metalloendopeptidase OMA1, mitochondrial, has 2 isoforms, a 524 amino acid long isoform that is 60 kDa and a short 486 amino acid isoform that is 56 kDa; widely expressed, with strong expression in the heart, skeletal muscle, kidney and liver; participates in the quality control system in the inner membrane of mitochondria following stress conditions that induce loss of mitochondrial membrane potential, mediates cleavage of OPA1 at S1 position, leading to OPA1 inactivation and negative regulation of mitochondrial fusion. Its role in mitochondrial quality control is essential for regulating lipid metabolism as well as to maintain body temperature and energy expenditure under cold-stress conditions. Studies are being performed on the relationship of this protein to amyotrophic lateral sclerosis, lateral sclerosis, childhood medulloblastoma, and medulloblastoma. OMA1 protein involvement has been observed with relation to diet induced thermogenesis, glucose metabolic process, misfolded or incompletely synthesized protein catabolic process, lipid metabolic process, negative regulation of mitochondrial fusion, and cristae formation processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3820
Species: Mu
Applications: IHC, WB
AF2258
Species: Mu
Applications: IHC, WB
NB100-2216
Species: Ch, Hu, Mu
Applications: ICC/IF, PAGE, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-37602
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB500-517
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
2428-FC
Species: Hu
Applications: Bind
NBP1-89530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3770
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92564
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-91931
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
419-ML
Species: Mu
Applications: BA
AF2685
Species: Hu
Applications: IHC, Simple Western, WB

Publications for OMA1 Protein (NBP2-30971PEP) (0)

There are no publications for OMA1 Protein (NBP2-30971PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OMA1 Protein (NBP2-30971PEP) (0)

There are no reviews for OMA1 Protein (NBP2-30971PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for OMA1 Protein (NBP2-30971PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OMA1 Products

Array NBP2-30971PEP

Research Areas for OMA1 Protein (NBP2-30971PEP)

Find related products by research area.

Blogs on OMA1

There are no specific blogs for OMA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our OMA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol OMA1