OLFM-L3 Recombinant Protein Antigen

Images

 
There are currently no images for OLFM-L3 Recombinant Protein Antigen (NBP2-68601PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

OLFM-L3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OLFM-L3.

Source: E. coli

Amino Acid Sequence: LVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAEKEREALRTEADTISGRVDRLEREVDYLETQNPALPCVEFDEKVTGGPGTKGKGRRNE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OLFML3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68601.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for OLFM-L3 Recombinant Protein Antigen

  • HNOEL-iso
  • HNOEL-isoOLF44
  • hOLF44
  • OLF44
  • olfactomedin-like 3
  • olfactomedin-like protein 3
  • OLFML3
  • OLFM-L3

Background

Secreted scaffold protein that plays an essential role in dorsoventral patterning during early development.Stabilizes axial formation by restricting chordin (CHRD) activity on the dorsal side. Acts by facilitating theassociation between the tolloid proteases and their substrate chordin (CHRD), leading to enhance chordin (CHRD)degradation . May have matrix-related function involved in placental and embryonic development, or playa similar role in other physiological processes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00118427-M06
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2039
Species: Hu
Applications: IHC, Simple Western, WB
NB100-58824
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IP, WB
314-BP
Species: Hu
Applications: BA, BA
NBP1-88837
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00009079-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
H00006496-M04
Species: Hu
Applications: ELISA, WB
NBP1-80920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56467
Species: Ca, Hu, Pm
Applications: WB
AF6480
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-24551
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-31617
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82512
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP2-68601PEP
Species: Hu
Applications: AC

Publications for OLFM-L3 Recombinant Protein Antigen (NBP2-68601PEP) (0)

There are no publications for OLFM-L3 Recombinant Protein Antigen (NBP2-68601PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OLFM-L3 Recombinant Protein Antigen (NBP2-68601PEP) (0)

There are no reviews for OLFM-L3 Recombinant Protein Antigen (NBP2-68601PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for OLFM-L3 Recombinant Protein Antigen (NBP2-68601PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OLFM-L3 Products

Bioinformatics Tool for OLFM-L3 Recombinant Protein Antigen (NBP2-68601PEP)

Discover related pathways, diseases and genes to OLFM-L3 Recombinant Protein Antigen (NBP2-68601PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OLFM-L3 Recombinant Protein Antigen (NBP2-68601PEP)

Discover more about diseases related to OLFM-L3 Recombinant Protein Antigen (NBP2-68601PEP).
 

Pathways for OLFM-L3 Recombinant Protein Antigen (NBP2-68601PEP)

View related products by pathway.

Blogs on OLFM-L3

There are no specific blogs for OLFM-L3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our OLFM-L3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol OLFML3