Olfactomedin-2/Noelin-2 Antibody

Images

 
Immunohistochemistry-Paraffin: Olfactomedin-2/Noelin-2 Antibody [NBP2-31692] - OLFM2 Antibody [NBP2-31692] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Olfactomedin-2/Noelin-2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLFYNKYQSNVVVKYHFRSRSVLVQRSLPGAGYNNTFPYSWGGFSDMDFMVDES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OLFM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Olfactomedin-2/Noelin-2 Protein (NBP2-31692PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Olfactomedin-2/Noelin-2 Antibody

  • neuronal olfactomedin related ER localized protein 2
  • NOE2
  • NOE2noelin 2
  • NOELIN2
  • Noelin-2
  • NOELIN2_V1
  • olfactomedin 2
  • Olfactomedin2
  • Olfactomedin-2
  • OlfC
  • OLFM2
  • OM2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3446
Species: Hu
Applications: WB
H00118427-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF4636
Species: Mu
Applications: WB
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24535
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-651
Species: Hu
Applications: WB
NLS272
Species: Hu, Mu, Rt, Ha, Mk, Rb
Applications: IHC-P
NB100-325
Species: Hu
Applications: WB, ChIP, IP
NBP1-85884
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP1-91596
Species: Hu
Applications: WB
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-89883
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91697
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP2-31692
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Olfactomedin-2/Noelin-2 Antibody (NBP2-31692) (0)

There are no publications for Olfactomedin-2/Noelin-2 Antibody (NBP2-31692).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Olfactomedin-2/Noelin-2 Antibody (NBP2-31692) (0)

There are no reviews for Olfactomedin-2/Noelin-2 Antibody (NBP2-31692). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Olfactomedin-2/Noelin-2 Antibody (NBP2-31692) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Olfactomedin-2/Noelin-2 Products

Bioinformatics Tool for Olfactomedin-2/Noelin-2 Antibody (NBP2-31692)

Discover related pathways, diseases and genes to Olfactomedin-2/Noelin-2 Antibody (NBP2-31692). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Olfactomedin-2/Noelin-2 Antibody (NBP2-31692)

Discover more about diseases related to Olfactomedin-2/Noelin-2 Antibody (NBP2-31692).
 

Pathways for Olfactomedin-2/Noelin-2 Antibody (NBP2-31692)

View related products by pathway.

PTMs for Olfactomedin-2/Noelin-2 Antibody (NBP2-31692)

Learn more about PTMs related to Olfactomedin-2/Noelin-2 Antibody (NBP2-31692).

Blogs on Olfactomedin-2/Noelin-2

There are no specific blogs for Olfactomedin-2/Noelin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Olfactomedin-2/Noelin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OLFM2
Entrez
Uniprot