ODZ3 Antibody

Images

 
Western Blot: ODZ3 Antibody [NBP2-13687] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-2 OS
Immunocytochemistry/ Immunofluorescence: ODZ3 Antibody [NBP2-13687] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ODZ3 Antibody [NBP2-13687] - Staining of human pancreas shows moderate membranous positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ODZ3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EPSYELVKSQQWDDIPPIFGVQQQVARQAKAFLSLGKMAEVQVSRRRAGG AQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TENM3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ODZ3 Protein (NBP2-13687PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ODZ3 Antibody

  • FLJ10474
  • FLJ10886
  • KIAA1455odd Oz/Ten-m homolog 3
  • odz, odd Oz/ten-m homolog 3 (Drosophila)
  • ODZ3-like protein
  • Protein Odd Oz/ten-m homolog 3
  • ten-3
  • tenascin-M3
  • teneurin-3
  • Ten-m3
  • TNM3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6324
Species: Hu
Applications: WB
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-59811
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB5628
Species: Hu, Mu
Applications: WB
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
MAB5809
Species: Hu
Applications: WB
H00003836-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for ODZ3 Antibody (NBP2-13687) (0)

There are no publications for ODZ3 Antibody (NBP2-13687).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ODZ3 Antibody (NBP2-13687) (0)

There are no reviews for ODZ3 Antibody (NBP2-13687). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ODZ3 Antibody (NBP2-13687) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ODZ3 Products

ODZ3 NBP2-13687

Bioinformatics Tool for ODZ3 Antibody (NBP2-13687)

Discover related pathways, diseases and genes to ODZ3 Antibody (NBP2-13687). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ODZ3 Antibody (NBP2-13687)

Discover more about diseases related to ODZ3 Antibody (NBP2-13687).

Research Areas for ODZ3 Antibody (NBP2-13687)

Find related products by research area.

Blogs on ODZ3

There are no specific blogs for ODZ3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ODZ3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TENM3