Odf1 Antibody

Western Blot: Odf1 Antibody [NBP2-38050] - Analysis of mouse sperm Odfs or bacterially expressed Odf1-MBP using NBP2-38050 (A) or anti-MBP (B). NIH/3T3 cell lysate serves as negative control. Data from the Independent Validation Initiative at antibodies-online.com.

Immunocytochemistry/Immunofluorescence: Odf1 Antibody [NBP2-38050] - Cells were transfected with Odf1 tagged with ECFP (green). NBP2-38050 (red) detects exogenous Odf1 protein. The pictures on the right show the red and green channels merged with DAPI counterstain (blue). Data from the Independent Validation Initiative at antibodies-online.com.

Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.

Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human testis shows moderate cytoplasmic positivity in mature spermatids.

Immunohistochemistry: Odf1 Antibody [NBP2-38050] - Staining of mouse testicular sections with NBP2-38050 (green, a). DAPI counterstain in blue (b). Merge image in (c). Data from the Independent Validation Initiative at antibodies-online.com.

Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human stomach shows no positivity in glandular cells as expected.

Product Discontinued

Odf1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ODF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB data from the Independent Validation Initiative at antibodies-online.com. Reported ICC-IF application. Data from the Independent Validation Initiative at antibodies-online.com.

Reactivity Notes

Reported reactivity in mouse testicular sections. Data from the Independent Validation Initiative at antibodies-online.com.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Odf1 Antibody

• cancer/testis antigen 133
• CT133
• HSPB10
• MGC129928
• MGC129929
• ODF
• ODF2
• ODF27
• ODFP
• ODFPG
• ODFPGA
• ODFPGB
• outer dense fiber of sperm tails 1
• outer dense fiber of sperm tails, 27-kD
• outer dense fiber protein 1
• outer dense fibre of sperm tails 1
• RT7
• SODF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Reviews for Odf1 Antibody (NBP2-38050) (3)

Average Rating: 5

(Based on 3 reviews)

We have 3 reviews tested in 2 species: Human, Mouse.

reviewed by: Verified Customer IF Mouse 12/04/2018

Summary

• Application: Immunofluorescence
• Sample Tested: Adult mouse testis
• Species: Mouse
• Lot: R90119

reviewed by: Verified Customer ICC Human 12/04/2018

Summary

• Application: Immunocytochemistry
• Sample Tested: Transfected mouse cell line
• Species: Human
• Lot: R90119

Comments

• Comments: NBP2-38050 specifically detects exogenously expressed Odf1-ECFP, without any further cellular cross reactivity.

reviewed by: Verified Customer WB Mouse 12/04/2018

Summary

• Application: Western Blot
• Sample Tested: Cell Lysates
• Species: Mouse
• Lot: R90119

Comments

• Comments: NBP2-38050 detected proteins within the expected MW range for Odf1 in mouse Odfs (approximately 27kDa) and bacterial extracts containing ODF1-MBP (approximately 70kDa). No protein was detected in the negative control NIH/3T3 lysates.

Bioinformatics

• Gene Symbol: ODF1
• Uniprot:
  • Q14990(Human)