Recombinant Human Ocular development associated gene GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Ocular development associated gene GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-269 of Human GATAD1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSGGGGFGAATFASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKESVANHL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
GATAD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
55.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ocular development associated gene GST (N-Term) Protein

  • FLJ22489
  • GATA zinc finger domain containing 1
  • GATA zinc finger domain-containing protein 1
  • ocular development associated
  • Ocular development-associated gene protein
  • ODAGFLJ40695
  • RG083M05.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-22261
Species: Ch, Hu, Mu
Applications: IP, WB
H00010263-B01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DY262
Species: Hu
Applications: ELISA
NBP1-59875
Species: Hu
Applications: WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-97759
Species: Hu
Applications: IHC, IHC-P, IP, WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-87431
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Ocular development associated gene Recombinant Protein (H00057798-P01) (0)

There are no publications for Ocular development associated gene Recombinant Protein (H00057798-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ocular development associated gene Recombinant Protein (H00057798-P01) (0)

There are no reviews for Ocular development associated gene Recombinant Protein (H00057798-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ocular development associated gene Recombinant Protein (H00057798-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ocular development associated gene Products

Bioinformatics Tool for Ocular development associated gene Recombinant Protein (H00057798-P01)

Discover related pathways, diseases and genes to Ocular development associated gene Recombinant Protein (H00057798-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ocular development associated gene Recombinant Protein (H00057798-P01)

Discover more about diseases related to Ocular development associated gene Recombinant Protein (H00057798-P01).
 

Pathways for Ocular development associated gene Recombinant Protein (H00057798-P01)

View related products by pathway.

Research Areas for Ocular development associated gene Recombinant Protein (H00057798-P01)

Find related products by research area.

Blogs on Ocular development associated gene

There are no specific blogs for Ocular development associated gene, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ocular development associated gene GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GATAD1