Ocular development associated gene Recombinant Protein Antigen

Images

 
There are currently no images for Ocular development associated gene Recombinant Protein Antigen (NBP2-57351PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ocular development associated gene Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ocular development associated gene.

Source: E.coli

Amino Acid Sequence: MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GATAD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-57351 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Ocular development associated gene Recombinant Protein Antigen

  • FLJ22489
  • GATA zinc finger domain containing 1
  • GATA zinc finger domain-containing protein 1
  • ocular development associated
  • Ocular development-associated gene protein
  • ODAGFLJ40695
  • RG083M05.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80920
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-22261
Species: Hu, Mu, Ch
Applications: WB, IP
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47492
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF262
Species: Hu
Applications: WB, IHC, ICC, Neut
NBP1-86784
Species: Hu
Applications: IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Ocular development associated gene Recombinant Protein Antigen (NBP2-57351PEP) (0)

There are no publications for Ocular development associated gene Recombinant Protein Antigen (NBP2-57351PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ocular development associated gene Recombinant Protein Antigen (NBP2-57351PEP) (0)

There are no reviews for Ocular development associated gene Recombinant Protein Antigen (NBP2-57351PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Ocular development associated gene Recombinant Protein Antigen (NBP2-57351PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Ocular development associated gene Recombinant Protein Antigen (NBP2-57351PEP)

Discover related pathways, diseases and genes to Ocular development associated gene Recombinant Protein Antigen (NBP2-57351PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ocular development associated gene Recombinant Protein Antigen (NBP2-57351PEP)

Discover more about diseases related to Ocular development associated gene Recombinant Protein Antigen (NBP2-57351PEP).
 

Pathways for Ocular development associated gene Recombinant Protein Antigen (NBP2-57351PEP)

View related products by pathway.

Research Areas for Ocular development associated gene Recombinant Protein Antigen (NBP2-57351PEP)

Find related products by research area.

Blogs on Ocular development associated gene

There are no specific blogs for Ocular development associated gene, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ocular development associated gene Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GATAD1