Recombinant Human Ocular development associated gene Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Ocular development associated gene Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 82-190 of Human GATAD1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GATAD1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ocular development associated gene Protein

  • FLJ22489
  • GATA zinc finger domain containing 1
  • GATA zinc finger domain-containing protein 1
  • ocular development associated
  • Ocular development-associated gene protein
  • ODAGFLJ40695
  • RG083M05.2

Background

GATAD1 - GATA zinc finger domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-22261
Species: Hu, Mu, Ch
Applications: WB, IP
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-86784
Species: Hu
Applications: IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00057798-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Ocular development associated gene Partial Recombinant Protein (H00057798-Q01) (0)

There are no publications for Ocular development associated gene Partial Recombinant Protein (H00057798-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ocular development associated gene Partial Recombinant Protein (H00057798-Q01) (0)

There are no reviews for Ocular development associated gene Partial Recombinant Protein (H00057798-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ocular development associated gene Partial Recombinant Protein (H00057798-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ocular development associated gene Products

Bioinformatics Tool for Ocular development associated gene Partial Recombinant Protein (H00057798-Q01)

Discover related pathways, diseases and genes to Ocular development associated gene Partial Recombinant Protein (H00057798-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ocular development associated gene Partial Recombinant Protein (H00057798-Q01)

Discover more about diseases related to Ocular development associated gene Partial Recombinant Protein (H00057798-Q01).
 

Pathways for Ocular development associated gene Partial Recombinant Protein (H00057798-Q01)

View related products by pathway.

Research Areas for Ocular development associated gene Partial Recombinant Protein (H00057798-Q01)

Find related products by research area.

Blogs on Ocular development associated gene

There are no specific blogs for Ocular development associated gene, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ocular development associated gene Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GATAD1