OCTN2/SLC22A5 Antibody - BSA Free

Western Blot: OCTN2/SLC22A5 Antibody [NBP2-83304] - WB Suggested Anti-SLC22A5 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellSLC22A5 is supported by BioGPS gene expression data to be expressed in HeLa

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

OCTN2/SLC22A5 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of OCTN2/SLC22A5. Peptide sequence: TLFLPESFGTPLPDTIDQMLRVKGMKHRKTPSHTRMLKDGQERPTILKST The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC22A5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for OCTN2/SLC22A5 Antibody - BSA Free

• CDSP
• FLJ46769
• High-affinity sodium-dependent carnitine cotransporter
• OCTN2
• OCTN2high-affinity sodium dependent carnitine cotransporter
• OCTN2VT
• organic cation transporter 2
• organic cation transporter 5
• Organic cation/carnitine transporter 2
• SCD
• SLC22A5
• solute carrier family 22 (organic cation transporter), member 5
• solute carrier family 22 (organic cation/carnitine transporter), member 5
• solute carrier family 22 member 5

Background

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is a plasma integral membrane protein which functions both as an organic cation transporter and as a sodium-dependent high affinity carnitine transporter. The encoded protein is involved in the active cellular uptake of carnitine. Mutations in this gene are the cause of systemic primary carnitine deficiency (CDSP), an autosomal recessive disorder manifested early in life by hypoketotic hypoglycemia and acute metabolic decompensation, and later in life by skeletal myopathy or cardiomyopathy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC22A5