OBP2A Antibody


Western Blot: OBP2A Antibody [NBP1-98584] - Titration: 1.0 ug/ml Positive Control: Fetal Stomach.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

OBP2A Antibody Summary

The immunogen for this antibody is OBP2A - middle region. Peptide sequence NLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDY.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:1000
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OBP2A Antibody

  • hOBPIIa
  • OBP
  • OBP2C
  • OBPIIa
  • odorant binding protein 2A
  • odorant-binding protein 2a
  • Odorant-binding protein IIa
  • putative odorant-binding protein 2c


This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scavenger of highly concentrated or toxic odors. The protein is expressed as a monomer in the nasal mucus, and can bind diverse types of odorants with a higher affinity for aldehydes and fatty acids. This gene and a highly similar family member are located in a cluster of lipocalin genes on chromosome 9. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: ICC
Species: Hu
Applications: WB

Publications for OBP2A Antibody (NBP1-98584) (0)

There are no publications for OBP2A Antibody (NBP1-98584).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OBP2A Antibody (NBP1-98584) (0)

There are no reviews for OBP2A Antibody (NBP1-98584). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OBP2A Antibody (NBP1-98584) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional OBP2A Antibody Products

Related Products by Gene

Bioinformatics Tool for OBP2A Antibody (NBP1-98584)

Discover related pathways, diseases and genes to OBP2A Antibody (NBP1-98584). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OBP2A

There are no specific blogs for OBP2A, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our OBP2A Antibody and receive a gift card or discount.


Gene Symbol OBP2A

Customers Who Bought This Also Bought