Recombinant Human OATL1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human OATL1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 302 - 410 of Human OATL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YAGPEDGPHLRALHDLLTTYAVTHPQVSYCQGMSDLASPILAVMDHEGHAFVCFCGIMKRLAANFHPDGRAMATKFAHLKLLLRHADPDFYQYLQEAGADDLFFCYRWL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TBC1D25
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OATL1 Protein

  • MG81
  • MGC126866
  • MGC126868
  • MGC149732
  • OATL1MGC149731
  • ornithine aminotransferase-like 1
  • TBC1 domain family member 25
  • TBC1 domain family, member 25

Background

This gene encodes a protein with a TBC domain and may function as a Rab GTPase activating protein. This gene was previously known as ornithine aminotransferase-like 1, but has no similarity to ornithine aminotransferase. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89976
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-46538
Species: Hu
Applications: WB, IHC
NBP2-32480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-79990
Species: Hu
Applications: WB, IHC, IHC-P
NB300-104
Species: Hu, Mu, Rt, Bv, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, IHC-FrFl
H00023415-R03
Species: Hu
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
MAB17791
Species: Hu, Mu
Applications: WB
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004943-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for OATL1 Partial Recombinant Protein (H00004943-Q01) (0)

There are no publications for OATL1 Partial Recombinant Protein (H00004943-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OATL1 Partial Recombinant Protein (H00004943-Q01) (0)

There are no reviews for OATL1 Partial Recombinant Protein (H00004943-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OATL1 Partial Recombinant Protein (H00004943-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OATL1 Products

Bioinformatics Tool for OATL1 Partial Recombinant Protein (H00004943-Q01)

Discover related pathways, diseases and genes to OATL1 Partial Recombinant Protein (H00004943-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OATL1

There are no specific blogs for OATL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Synapsin I Antibody
NB300-104-100ul
OATL1 Antibody
NBP2-13412

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OATL1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TBC1D25