O-GlcNAc Transferase p110 subunit Antibody - BSA Free

Western Blot: O-GlcNAc Transferase p110 subunit Antibody [NBP1-52925] - Analysis of 721_B whole cell lysates, Antibody Dilution: 1.0 ug/ml OGT is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Immunohistochemistry-Paraffin: O-GlcNAc Transferase p110 subunit Antibody [NBP1-52925] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in processes of pinealocytes and endothelial cells in blood vessels; Primary Antibody Concentration: 1:100

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

O-GlcNAc Transferase p110 subunit Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to OGT(O-linked N-acetylglucosamine (GlcNAc) transferase) The peptide sequence was selected from the N terminal of OGT. Peptide sequence ASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OGT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for O-GlcNAc Transferase p110 subunit Antibody - BSA Free

• EC 2.4.1
• EC 2.4.1.255
• FLJ23071
• HRNT1
• MGC22921
• O-GlcNAc transferase p110 subunit
• O-GlcNAc transferase subunit p110
• OGlcNAc Transferase
• O-GlcNAc Transferase
• O-GLCNAC
• OGT
• O-linked N-acetylglucosamine (GlcNAc) transferase(UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)
• O-linked N-acetylglucosamine transferase 110 kDa subunit
• UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDasubunit
• uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase

Background

OGT catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains nine tetratricopeptide repeats and a putative bipartite nuclear localization signal. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains nine tetratricopeptide repeats and a putative bipartite nuclear localization signal. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OGT
• Uniprot:
  • O15294()