O-GlcNAc Transferase p110 subunit Antibody

Images

 
Western Blot: O-GlcNAc Transferase p110 subunit Antibody [NBP1-52925] - Analysis of 721_B whole cell lysates, Antibody Dilution: 1.0 ug/ml OGT is strongly supported by BioGPS gene expression data to be expressed in ...read more
Immunocytochemistry/ Immunofluorescence: O-GlcNAc Transferase p110 subunit Antibody [NBP1-52925] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in processes of ...read more
Western Blot: O-GlcNAc Transferase p110 subunit Antibody [NBP1-52925] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

O-GlcNAc Transferase p110 subunit Antibody Summary

Immunogen
Synthetic peptides corresponding to OGT(O-linked N-acetylglucosamine (GlcNAc) transferase) The peptide sequence was selected from the N terminal of OGT. Peptide sequence ASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OGT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against OGT and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for O-GlcNAc Transferase p110 subunit Antibody

  • EC 2.4.1
  • EC 2.4.1.255
  • FLJ23071
  • HRNT1
  • MGC22921
  • O-GlcNAc transferase p110 subunit
  • O-GlcNAc transferase subunit p110
  • OGlcNAc Transferase
  • O-GlcNAc Transferase
  • O-GLCNAC
  • OGT
  • O-linked N-acetylglucosamine (GlcNAc) transferase(UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)
  • O-linked N-acetylglucosamine transferase 110 kDa subunit
  • UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDasubunit
  • uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase

Background

OGT catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains nine tetratricopeptide repeats and a putative bipartite nuclear localization signal. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains nine tetratricopeptide repeats and a putative bipartite nuclear localization signal. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81244
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-02056
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2200
Species: Hu
Applications: WB, IP
NBP1-83288
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24769
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
NBP2-14977
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52925
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for O-GlcNAc Transferase p110 subunit Antibody (NBP1-52925) (0)

There are no publications for O-GlcNAc Transferase p110 subunit Antibody (NBP1-52925).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for O-GlcNAc Transferase p110 subunit Antibody (NBP1-52925) (0)

There are no reviews for O-GlcNAc Transferase p110 subunit Antibody (NBP1-52925). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for O-GlcNAc Transferase p110 subunit Antibody (NBP1-52925) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional O-GlcNAc Transferase p110 subunit Products

Bioinformatics Tool for O-GlcNAc Transferase p110 subunit Antibody (NBP1-52925)

Discover related pathways, diseases and genes to O-GlcNAc Transferase p110 subunit Antibody (NBP1-52925). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for O-GlcNAc Transferase p110 subunit Antibody (NBP1-52925)

Discover more about diseases related to O-GlcNAc Transferase p110 subunit Antibody (NBP1-52925).
 

Pathways for O-GlcNAc Transferase p110 subunit Antibody (NBP1-52925)

View related products by pathway.

PTMs for O-GlcNAc Transferase p110 subunit Antibody (NBP1-52925)

Learn more about PTMs related to O-GlcNAc Transferase p110 subunit Antibody (NBP1-52925).
 

Research Areas for O-GlcNAc Transferase p110 subunit Antibody (NBP1-52925)

Find related products by research area.

Blogs on O-GlcNAc Transferase p110 subunit

There are no specific blogs for O-GlcNAc Transferase p110 subunit, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our O-GlcNAc Transferase p110 subunit Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OGT
Entrez
Uniprot