O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 947-1046 of human O-GlcNAc Transferase p110 subunit (O15294). PGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
OGT |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Chromatin Immunoprecipitation (ChIP) 1:500 - 1:1000
- Immunoprecipitation 1:500 - 1:1000
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)
Background
Diffusion of metabolites and small non-nuclear molecules as well as active, mediated import of protein and export of protein and RNA through the nuclear envelope occurs through nuclear pore complexes or NPC's. NPC's contain up to 100 different polypeptides which have a combined mass of about 125 megadaltons. The channel available for passive transport through the NPC is about 9-10 nm in diameter while carrier mediated changes in the NPC result in a ~25 nm channel used for larger, actively transported molecules. Of the 100 polypeptides, at least 8 of these are O-linked N-acetylglycosamine-modified in mammalian cells. All of the mammalian O-linked glycoproteins contain multiple copies of phenylalanine, glycine dipeptide repeats dispersed throughout part of their sequence. Studies indicate that the NPC O-linked glycoproteins have a direct role in nuclear protein import.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: IP, KD, WB
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for O-GlcNAc Transferase p110 subunit Antibody (NBP3-16203) (0)
There are no publications for O-GlcNAc Transferase p110 subunit Antibody (NBP3-16203).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for O-GlcNAc Transferase p110 subunit Antibody (NBP3-16203) (0)
There are no reviews for O-GlcNAc Transferase p110 subunit Antibody (NBP3-16203).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for O-GlcNAc Transferase p110 subunit Antibody (NBP3-16203) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional O-GlcNAc Transferase p110 subunit Products
Research Areas for O-GlcNAc Transferase p110 subunit Antibody (NBP3-16203)
Find related products by research area.
|
Blogs on O-GlcNAc Transferase p110 subunit