NYNRIN Antibody

Images

 
Immunohistochemistry-Paraffin: NYNRIN Antibody [NBP1-90632] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NYNRIN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PNLLALQLSDSTLADIIARLQAGQKLSGSSPFSSAFNSLSLDKESGLLMFKGDKKPRVWVVPTQLRRDLIFSVHDVPLGAHQRPEETYKKLRLLGWWPGMQEHVKDYCRSCLFCIPRNLIGSELKVIES
Specificity
Specificity of human NYNRIN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NYNRIN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NYNRIN Protein (NBP1-90632PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NYNRIN Antibody

  • CGIN1
  • Cousin of GIN1
  • FLJ11811
  • NYN domain and retroviral integrase catalytic domain-containing protein
  • NYN domain and retroviral integrase containing
  • protein NYNRIN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76531
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-16382
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24643
Species: Mu, Rt
Applications: WB
NBP2-34594
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP3-04411
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Ma-Op, Pm
Applications: WB
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NYNRIN Antibody (NBP1-90632) (0)

There are no publications for NYNRIN Antibody (NBP1-90632).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NYNRIN Antibody (NBP1-90632) (0)

There are no reviews for NYNRIN Antibody (NBP1-90632). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NYNRIN Antibody (NBP1-90632) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NYNRIN Products

Array NBP1-90632

Bioinformatics Tool for NYNRIN Antibody (NBP1-90632)

Discover related pathways, diseases and genes to NYNRIN Antibody (NBP1-90632). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NYNRIN

There are no specific blogs for NYNRIN, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NYNRIN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NYNRIN