NUP54 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NUP54. Peptide sequence: AGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTRL The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NUP54 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for NUP54 Antibody - BSA Free
Background
The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. This gene encodes a member of the phe-gly (FG) repeat-containing nucleoporin subset. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IB, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu
Applications: WB
Publications for NUP54 Antibody (NBP2-87972) (0)
There are no publications for NUP54 Antibody (NBP2-87972).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NUP54 Antibody (NBP2-87972) (0)
There are no reviews for NUP54 Antibody (NBP2-87972).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NUP54 Antibody (NBP2-87972) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NUP54 Products
Research Areas for NUP54 Antibody (NBP2-87972)
Find related products by research area.
|
Blogs on NUP54