NUP50 Antibody (4H7) - Azide and BSA Free

Western Blot: NUP50 Antibody (4H7) [H00010762-M01] - NUP50 monoclonal antibody (M01), clone 4H7. Analysis of NUP50 expression in Hela S3 NE.

Sandwich ELISA: NUP50 Antibody (4H7) [H00010762-M01] - Detection limit for recombinant GST tagged NUP50 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4H7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NUP50 Antibody (4H7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse NUP50 Antibody (4H7) - Azide and BSA Free (H00010762-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: NUP50 (NP_705931.1, 342 a.a. ~ 439 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKD
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NUP50
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NUP50 Antibody (4H7) - Azide and BSA Free

• 50 kDa nucleoporin
• MGC39961
• NPAP60
• NPAP60LNucleoporin Nup50
• nuclear pore complex protein Nup50
• Nuclear pore-associated protein 60 kDa-like
• nuclear pore-associated protein 60L
• nucleoporin 50kD
• nucleoporin 50kDa

Background

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUP50
• Uniprot:
  • NP_705931(Human)