NUP37 Antibody - BSA Free

Western Blot: NUP37 Antibody [NBP2-87970] - Host: Rabbit. Target Name: NUP37. Sample Tissue: Human DLD1 Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NUP37 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NUP37 Antibody - BSA Free (NBP2-87970) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NUP37. Peptide sequence: KNTFKVGAVAGNDWLIWDITRSSYPQNKRPVHMDRACLFRWSTISENLFA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUP37
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NUP37 Antibody - BSA Free

• MGC5585
• nucleoporin 37kDa
• nucleoporin Nup37
• Nup107-160 subcomplex subunit Nup37
• p37FLJ22618

Background

Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes(NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP37 is part of one such subcomplex,Nup107-160 (Loiodice et al., 2004 (PubMed 15146057)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUP37