Recombinant Human NUP214 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NUP214 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 35431 of Human NUP214 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NUP214

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NUP214 Protein

  • 214 kDa nucleoporin
  • CAINputative oncogene
  • D9S46Enuclear pore complex protein Nup214
  • KIAA0023
  • MGC104525
  • N214
  • nucleoporin 214kD (CAIN)
  • nucleoporin 214kDa
  • Nucleoporin Nup214
  • p250
  • Protein CAN

Background

NUP214 - nucleoporin 214kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NB100-93329
Species: Hu
Applications: WB, ICC/IF, IP
NB100-93325
Species: Hu
Applications: WB, IP
NBP1-91745
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82658
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP

Publications for NUP214 Partial Recombinant Protein (H00008021-Q01) (0)

There are no publications for NUP214 Partial Recombinant Protein (H00008021-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUP214 Partial Recombinant Protein (H00008021-Q01) (0)

There are no reviews for NUP214 Partial Recombinant Protein (H00008021-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUP214 Partial Recombinant Protein (H00008021-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NUP214 Products

Bioinformatics Tool for NUP214 Partial Recombinant Protein (H00008021-Q01)

Discover related pathways, diseases and genes to NUP214 Partial Recombinant Protein (H00008021-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUP214 Partial Recombinant Protein (H00008021-Q01)

Discover more about diseases related to NUP214 Partial Recombinant Protein (H00008021-Q01).
 

Pathways for NUP214 Partial Recombinant Protein (H00008021-Q01)

View related products by pathway.

PTMs for NUP214 Partial Recombinant Protein (H00008021-Q01)

Learn more about PTMs related to NUP214 Partial Recombinant Protein (H00008021-Q01).
 

Research Areas for NUP214 Partial Recombinant Protein (H00008021-Q01)

Find related products by research area.

Blogs on NUP214

There are no specific blogs for NUP214, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NUP214 Antibody
NB100-2244

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NUP214 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NUP214