NUDT2 Antibody

Western Blot: NUDT2 Antibody [H00000318-D01P] - Analysis of NUDT2 expression in transfected 293T cell line by NUDT2 polyclonal antibody.Lane 1: NUDT2 transfected lysate(16.80 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

NUDT2 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: NUDT2 (NP_001152.1, 1 a.a. - 147 a.a.) full-length human protein. MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
• Specificity: NUDT2 - nudix (nucleoside diphosphate linked moiety X)-type motif 2,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUDT2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NUDT2 Antibody

• Ap4A hydrolase 1
• Ap4A hydrolase
• Ap4Aase
• APAH1Diadenosine 5'-5'''-P1
• bis(5'-nucleosyl)-tetraphosphatase (asymmetrical)
• bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
• diadenosine 5'-5''-P1
• Diadenosine tetraphosphatase
• EC 3.6.1.17
• MGC10404
• Nucleoside diphosphate-linked moiety X motif 2
• nudix (nucleoside diphosphate linked moiety X)-type motif 2
• Nudix motif 2
• P4-tetraphosphate asymmetrical hydrolase
• P4-tetraphosphate pyrophosphohydrolase

Background

This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUDT2
• Entrez:
  • 318(Human)
• Uniprot:
  • NP_001152.1(Human)