NUDT2 Antibody

Images

 
Western Blot: NUDT2 Antibody [H00000318-B01P] - Analysis of NUDT2 expression in human placenta.
Western Blot: NUDT2 Antibody [H00000318-B01P] - Analysis of NUDT2 expression in transfected 293T cell line by NUDT2 polyclonal antibody. Lane 1: NUDT2 transfected lysate(16.17 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Product Discontinued
View other related NUDT2 Primary Antibodies

Order Details


    • Catalog Number
      H00000318-B01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NUDT2 Antibody Summary

Immunogen
NUDT2 (NP_001152.1, 1 a.a. - 147 a.a.) full-length human protein. MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Specificity
NUDT2 - nudix (nucleoside diphosphate linked moiety X)-type motif 2,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NUDT2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Control
NUDT2 Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NUDT2 Antibody

  • Ap4A hydrolase 1
  • Ap4A hydrolase
  • Ap4Aase
  • APAH1Diadenosine 5'-5'''-P1
  • bis(5'-nucleosyl)-tetraphosphatase (asymmetrical)
  • bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
  • diadenosine 5'-5''-P1
  • Diadenosine tetraphosphatase
  • EC 3.6.1.17
  • MGC10404
  • Nucleoside diphosphate-linked moiety X motif 2
  • nudix (nucleoside diphosphate linked moiety X)-type motif 2
  • Nudix motif 2
  • P4-tetraphosphate asymmetrical hydrolase
  • P4-tetraphosphate pyrophosphohydrolase

Background

This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-89062
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
MAB7047
Species: Hu
Applications: WB, ICC
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00002592-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-55046
Species: Hu
Applications: WB
H00000318-B01P
Species: Hu
Applications: WB

Publications for NUDT2 Antibody (H00000318-B01P) (0)

There are no publications for NUDT2 Antibody (H00000318-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDT2 Antibody (H00000318-B01P) (0)

There are no reviews for NUDT2 Antibody (H00000318-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUDT2 Antibody (H00000318-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NUDT2 Products

Bioinformatics Tool for NUDT2 Antibody (H00000318-B01P)

Discover related pathways, diseases and genes to NUDT2 Antibody (H00000318-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUDT2 Antibody (H00000318-B01P)

Discover more about diseases related to NUDT2 Antibody (H00000318-B01P).
 

Pathways for NUDT2 Antibody (H00000318-B01P)

View related products by pathway.

Research Areas for NUDT2 Antibody (H00000318-B01P)

Find related products by research area.

Blogs on NUDT2

There are no specific blogs for NUDT2, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUDT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDT2
Entrez
Uniprot