Nuclear Factor Erythroid Derived 2 Antibody - BSA Free

Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-69226] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Nuclear Factor Erythroid Derived 2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to NFE2 (nuclear factor (erythroid-derived 2), 45kDa) The peptide sequence was selected from the N terminal of NFE2. Peptide sequence MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFE2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free

• Leucine zipper protein NF-E2
• NF-E2
• nuclear factor (erythroid-derived 2), 45kD
• nuclear factor (erythroid-derived 2), 45kDa
• Nuclear factor, erythroid-derived 2 45 kDa subunit
• p45 NF-E2
• p45
• transcription factor NF-E2 45 kDa subunit

Background

NFE2 is a component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation. NFE2 binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. NFE2 is requires MAFK or other small MAF proteins for binding to the NF-E2 motif. NFE2 may play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFE2
• Uniprot:
  • Q16621(Human)