Nuclear Factor Erythroid Derived 2 Antibody

Images

 
Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-69226] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nuclear Factor Erythroid Derived 2 Antibody Summary

Immunogen
Synthetic peptides corresponding to NFE2 (nuclear factor (erythroid-derived 2), 45kDa) The peptide sequence was selected from the N terminal of NFE2. Peptide sequence MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NFE2 and was validated on Western blot.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Nuclear Factor Erythroid Derived 2 Antibody

  • Leucine zipper protein NF-E2
  • NF-E2
  • nuclear factor (erythroid-derived 2), 45kD
  • nuclear factor (erythroid-derived 2), 45kDa
  • Nuclear factor, erythroid-derived 2 45 kDa subunit
  • p45 NF-E2
  • p45
  • transcription factor NF-E2 45 kDa subunit

Background

NFE2 is a component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation. NFE2 binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. NFE2 is requires MAFK or other small MAF proteins for binding to the NF-E2 motif. NFE2 may play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17791
Species: Hu, Mu
Applications: WB
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
MAB3809
Species: Hu, Mu
Applications: WB
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-55915
Species: Hu
Applications: WB, ICC/IF
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready

Publications for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-69226) (0)

There are no publications for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-69226).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-69226) (0)

There are no reviews for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-69226). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-69226) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nuclear Factor Erythroid Derived 2 Products

Bioinformatics Tool for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-69226)

Discover related pathways, diseases and genes to Nuclear Factor Erythroid Derived 2 Antibody (NBP1-69226). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-69226)

Discover more about diseases related to Nuclear Factor Erythroid Derived 2 Antibody (NBP1-69226).
 

Pathways for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-69226)

View related products by pathway.

PTMs for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-69226)

Learn more about PTMs related to Nuclear Factor Erythroid Derived 2 Antibody (NBP1-69226).

Blogs on Nuclear Factor Erythroid Derived 2

There are no specific blogs for Nuclear Factor Erythroid Derived 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nuclear Factor Erythroid Derived 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFE2
Uniprot