NSUN2 Antibody - BSA Free

Western Blot: NSUN2 Antibody [NBP2-85404] - Host: Rabbit. Target Name: NSUN2. Sample Type: PANC1 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NSUN2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NSUN2. Peptide sequence: LEKFHQFLVSETESGNISRQEAVSMIPPLLLNVRPHHKILDMCAAPGSKT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NSUN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NSUN2 Antibody - BSA Free

• EC 2.1.1
• EC 2.1.1.29
• FLJ20303,5-methycytoisine methyltransferase
• hTrm4
• member 2
• Myc-induced SUN-domain-containing protein
• NOL1/NOP2/Sun domain family 2
• NOL1/NOP2/Sun domain family member 2
• NOP2/Sun domain family, member 2
• SAKIMisu
• Substrate of AIM1/Aurora kinase B
• TRM4MISU
• tRNA (cytosine-5-)-methyltransferase NSUN2
• tRNA (cytosine-5-)-methyltransferase
• tRNA methyltransferase 4 homolog

Background

Maturation of cytoplasmic tRNAs includes splicing of introns, which are located 1 nucleotide 3-prime from the anticodon in all intron-containing tRNA genes. In tRNA-leu(CAA), the first position of the anticodon, C34, is converted to 5-methylcytosine, a modification necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. NSUN2 encodes a methyltransferase that catalyzes the intron-dependent formation of 5-methylcytosine at C34 of tRNA-leu(CAA) (Brzezicha et al., 2006 [PubMed 17071714]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NSUN2