NSDHL Antibody (3K3Q6)

Western Blot: NSDHL Antibody (3K3Q6) [NBP3-33288] - Western blot analysis of various lysates using NSDHL Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3K3Q6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

NSDHL Antibody (3K3Q6) Summary

• Description: Novus Biologicals Rabbit NSDHL Antibody (3K3Q6) (NBP3-33288) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human NSDHL (NP_057006.1).
  
  Sequence:
  GQHMVEQLLARGYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPSSNNKELFYRVNYIGTKNVIETCKEAGVQKLILTSSASVIF
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: NSDHL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NSDHL Antibody (3K3Q6)

• EC 1.1.1.170
• H105e3
• member 1
• NAD(P) dependent steroid dehydrogenase-like
• SDR31E1
• sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
• XAP104

Background

NSDHL is encoded by this gene is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in this gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males. Alternatively spliced transcript variants with differing 5' UTR have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NSDHL