NRK1 Antibody

Images

 
Western Blot: NRK1 Antibody [NBP1-79662] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Rt, Bv, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NRK1 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human C9orf95The immunogen for this antibody is C9orf95. Peptide sequence QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (93%), Equine (93%), Guinea Pig (93%), Bovine (93%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NMRK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against C9orf95 and was validated on Western blot.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-79662 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NRK1 Antibody

  • bA235O14.2
  • C9orf95
  • cDNA FLJ39825
  • EC 2.7.1.173
  • EC 2.7.1.22
  • EC 2.7.1.n4
  • FLJ20559
  • nicotinamide riboside kinase 1
  • Nicotinic acid riboside kinase 1
  • NmR-K 1
  • NMRK1
  • NRK 1
  • NRK1
  • Ribosylnicotinamide kinase 1
  • Ribosylnicotinic acid kinase 1
  • RNK 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84121
Species: Hu
Applications: IHC, IHC-P
NBP2-67358
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-56059
Species: Hu
Applications: IHC, IHC-P
NB100-56139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-42686
Species: Hu
Applications: WB (-), IHC, IP
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP1-80306
Species: Hu, Av
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB1774
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-13323
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready, KO
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB100-402
Species: Hu, Mu, Rt, Po, Ca, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for NRK1 Antibody (NBP1-79662)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NRK1 Antibody (NBP1-79662) (0)

There are no reviews for NRK1 Antibody (NBP1-79662). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NRK1 Antibody (NBP1-79662) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NRK1 Products

Bioinformatics Tool for NRK1 Antibody (NBP1-79662)

Discover related pathways, diseases and genes to NRK1 Antibody (NBP1-79662). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRK1 Antibody (NBP1-79662)

Discover more about diseases related to NRK1 Antibody (NBP1-79662).
 

Pathways for NRK1 Antibody (NBP1-79662)

View related products by pathway.

Blogs on NRK1

There are no specific blogs for NRK1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NMRK1
Uniprot