NRK1 Antibody - BSA Free

Western Blot: NRK1 Antibody [NBP1-79662] - 721_B cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NRK1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human C9orf95The immunogen for this antibody is C9orf95. Peptide sequence QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NMRK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NRK1 Antibody - BSA Free

• bA235O14.2
• C9orf95
• cDNA FLJ39825
• EC 2.7.1.173
• EC 2.7.1.22
• EC 2.7.1.n4
• FLJ20559
• nicotinamide riboside kinase 1
• Nicotinic acid riboside kinase 1
• NmR-K 1
• NMRK1
• NRK 1
• NRK1
• Ribosylnicotinamide kinase 1
• Ribosylnicotinic acid kinase 1
• RNK 1

Background

Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NRK1 Antibody (NBP1-79662)(1)

Publication using NBP1-79662

• Kamada M, Ikeda K, Manome Y Effect of Phosphoribosyltransferase Down-regulation on Malignant Glioma Cell Characteristics Anticancer Res. 2020-09-01 [PMID: 32878777] (WB, Human)

Bioinformatics

• Gene Symbol: NMRK1
• Uniprot:
  • NP_060351(Human)