Home » NRIF3 » NRIF3 Antibodies » NRIF3 Antibody (3F6)

NRIF3 Antibody (3F6)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: NRIF3 Antibody (3F6) [H00023421-M01] - ITGB3BP monoclonal antibody (M01), clone 3F6 Analysis of ITGB3BP expression in A-431.
Western Blot: NRIF3 Antibody (3F6) [H00023421-M01] - ITGB3BP monoclonal antibody (M01), clone 3F6 Analysis of ITGB3BP expression in A-431.
Immunocytochemistry/ Immunofluorescence: NRIF3 Antibody (3F6) [H00023421-M01] - Analysis of monoclonal antibody to ITGB3BP on A-431 cell. Antibody concentration 10 ug/ml.
Western Blot: NRIF3 Antibody (3F6) [H00023421-M01] - Analysis of ITGB3BP expression in transfected 293T cell line by ITGB3BP monoclonal antibody (M01), clone 3F6.Lane 1: ITGB3BP transfected lysate(20.2 KDa).Lane 2: ...read more
Sandwich ELISA: NRIF3 Antibody (3F6) [H00023421-M01] - Detection limit for recombinant GST tagged ITGB3BP is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
3F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NRIF3 Antibody (3F6) Summary

Immunogen
ITGB3BP (AAH14385, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTK
Specificity
ITGB3BP - integrin beta 3 binding protein (beta3-endonexin)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ITGB3BP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NRIF3 Antibody (3F6)

  • beta-3-endonexin
  • CENP-R
  • centromere protein R
  • HSU37139
  • integrin beta 3 binding protein (beta3-endonexin)
  • Integrin beta-3-binding protein
  • NRIF3CENPRbeta 3 endonexin
  • Nuclear receptor-interacting factor 3
  • TAP20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Aldo-keto
Reductase 1C1/AKR1C1 ...
MAB6529
Simple Western lane view shows lysates of HepG2 human hepatocellular carcinoma cell line and human liver tissue, loaded at 0.5 mg/mL. A specific band was detected for Aldo‑keto Reductase 1C1/AKR1C1 at approximately 41 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Aldo‑keto Reductase 1C1/AKR1C1 Monoclonal Antibody (Catalog # MAB6529) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and human liver tissue. PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human Aldo‑keto Reductase 1C1/AKR1C1 Monoclonal Antibody (Catalog # MAB6529) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Aldo‑keto Reductase 1C1/AKR1C1 at approximately 37 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: Simple Western, WB
CENPA Antibody
NBP2-92632
Immunocytochemistry/Immunofluorescence: CENPA Antibody [NBP2-92632] - Analysis of U-2 OS cells using CENPA . Blue: DAPI for nuclear staining.
Western Blot: CENPA Antibody [NBP2-92632] - Analysis of extracts of various cell lines, using CENPA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 180s.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
uPAR [HRP]
DUP00
(39 Publications)
Species: Hu
Applications: ELISA

TMEFF2/Tomoregulin-2 A
NBP2-01863
Western Blot: TMEFF2 Antibody (1F9) [NBP2-01863] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TMEFF2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-TMEFF2.
Immunohistochemistry-Paraffin: TMEFF2 Antibody (1F9) [NBP2-01863] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-TMEFF2 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: TMEFF2 Antibody (1F9) [NBP2-01863] - Staining of paraffin-embedded Carcinoma of Human prostate tissue using anti-TMEFF2 mouse monoclonal antibody.
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Thioredoxin
Reductase 1/TRXR1 Ant
NBP2-20619
Western Blot: thioredoxin reductase 1 Antibody [NBP2-20619] - Sample (30 ug of whole cell lysate)A: Molt-4 7. 5% SDS PAGE gel, diluted at 1:3000.
Western Blot: thioredoxin reductase 1 Antibody [NBP2-20619] - 50 ug mouse brain lysate/extract 7. 5% SDS-PAGE TrxR1 antibody [N3C2], Internal dilution: 1:1000.
Western Blot: thioredoxin reductase 1 Antibody [NBP2-20619] - 50 ug Rat brain lysate/extract 7. 5% SDS-PAGE TrxR1 antibody [N3C2], Internal dilution: 1:1000.
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TXNRD2 Antibody
NBP2-94256
Immunohistochemistry-Paraffin: TXNRD2 Antibody [NBP2-94256] - Paraffin-embedded human liver cancer using TXNRD2 .
Western Blot: TXNRD2 Antibody [NBP2-94256] - Analysis of extracts of various cell lines, using TXNRD2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.
Immunohistochemistry-Paraffin: TXNRD2 Antibody [NBP2-94256] - Paraffin-embedded human liver damage using TXNRD2 .
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(8 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
PAR1/Thrombin
Receptor Antibody (N2
NBP1-71770
Western Blot: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Analysis of PAR1 in whole cell lysate of Neuro2A cell line using 4ug/ml concentration of PAR1 antibody (clone N2-11). The antibody detected a strong band at ~60kDa position and another light band at ~80kDa, both of which appears to be the glycosylated forms of PAR1 protein.
Immunocytochemistry/Immunofluorescence: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Thrombin Receptor antibody was tested in HeLa cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Analysis of Thrombin Receptor on mouse skin using NBP1-71770.
(8 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
TfR (Transferrin
R) Antibody (OX26) - ...
NB200-585
Western Blot: TfR (Transferrin R) Antibody (OX26) [NB200-585] - Total protein from rat adrenal gland cells (PC12) and rat placenta was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-CD71 in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Flow Cytometry: TfR (Transferrin R) Antibody (OX26) [NB200-585] - Staining of rat spleen cells with mouse anti rat CD71: RPE.
Immunocytochemistry/Immunofluorescence: TfR (Transferrin R) Antibody (OX26) [NB200-585] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti TfR/Transferrin R (OX26) NB200-585 at a 1:100 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (red) at a 1:200 dilution. Nuclei were counterstained with DAPI (blue). Cells were imaged using a 40X objective.
(16 Publications)
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(23 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
FAK Antibody
(SR46-04)
NBP2-67327
Flow Cytometry: FAK Antibody (SR46-04) [NBP2-67327] - Analysis of Hela cells with FAK antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: FAK Antibody (SR46-04) [NBP2-67327] - Staining FAK in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: FAK Antibody (SR46-04) [NBP2-67327] - Analysis of paraffin-embedded human spleen tissue using anti-FAK antibody. Counter stained with hematoxylin.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
CCL2/JE/MCP-1 [HRP]
DCP00
(8 Reviews)
(209 Publications)
Species: Hu
Applications: ELISA
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(2 Publications)
Species: Hu
Applications: BA
IRF2BP2 Antibody
NBP1-93674
Immunocytochemistry/Immunofluorescence: IRF2BP2 Antibody [NBP1-93674] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.
Western Blot: IRF2BP2 Antibody [NBP1-93674] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Western Blot: IRF2BP2 Antibody [NBP1-93674] - Analysis in human cell line THP-1.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
CENPH Antibody
NBP1-82546
Immunohistochemistry-Paraffin: CENPH Antibody [NBP1-82546] - Staining of human tonsil shows weak to moderate nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: CENPH Antibody [NBP1-82546] - Staining of human skin shows weak to moderate nuclear positivity in a subset of squamous epithelial cells.
Immunohistochemistry-Paraffin: CENPH Antibody [NBP1-82546] - Staining of human small intestine shows weak to moderate nuclear positivity in a subset of glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on HeLa cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U2-OS cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(4 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB

Publications for NRIF3 Antibody (H00023421-M01) (0)

There are no publications for NRIF3 Antibody (H00023421-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRIF3 Antibody (H00023421-M01) (0)

There are no reviews for NRIF3 Antibody (H00023421-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NRIF3 Antibody (H00023421-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NRIF3 Products

Bioinformatics Tool for NRIF3 Antibody (H00023421-M01)

Discover related pathways, diseases and genes to NRIF3 Antibody (H00023421-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRIF3 Antibody (H00023421-M01)

Discover more about diseases related to NRIF3 Antibody (H00023421-M01).
 

Pathways for NRIF3 Antibody (H00023421-M01)

View related products by pathway.

PTMs for NRIF3 Antibody (H00023421-M01)

Learn more about PTMs related to NRIF3 Antibody (H00023421-M01).
 

Research Areas for NRIF3 Antibody (H00023421-M01)

Find related products by research area.

Blogs on NRIF3

There are no specific blogs for NRIF3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRIF3 Antibody (3F6) and receive a gift card or discount.


Bioinformatics

Gene Symbol ITGB3BP
Entrez
OMIM
Uniprot