NRIF3 Antibody (3F6)

Images

 
Western Blot: NRIF3 Antibody (3F6) [H00023421-M01] - ITGB3BP monoclonal antibody (M01), clone 3F6 Analysis of ITGB3BP expression in A-431.
Immunocytochemistry/ Immunofluorescence: NRIF3 Antibody (3F6) [H00023421-M01] - Analysis of monoclonal antibody to ITGB3BP on A-431 cell. Antibody concentration 10 ug/ml.
Western Blot: NRIF3 Antibody (3F6) [H00023421-M01] - Analysis of ITGB3BP expression in transfected 293T cell line by ITGB3BP monoclonal antibody (M01), clone 3F6.Lane 1: ITGB3BP transfected lysate(20.2 KDa).Lane 2: ...read more
Sandwich ELISA: NRIF3 Antibody (3F6) [H00023421-M01] - Detection limit for recombinant GST tagged ITGB3BP is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
3F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NRIF3 Antibody (3F6) Summary

Immunogen
ITGB3BP (AAH14385, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTK
Specificity
ITGB3BP - integrin beta 3 binding protein (beta3-endonexin)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ITGB3BP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NRIF3 Antibody (3F6)

  • beta-3-endonexin
  • CENP-R
  • centromere protein R
  • HSU37139
  • integrin beta 3 binding protein (beta3-endonexin)
  • Integrin beta-3-binding protein
  • NRIF3CENPRbeta 3 endonexin
  • Nuclear receptor-interacting factor 3
  • TAP20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6529
Species: Hu
Applications: Simple Western, WB
NBP2-92632
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DUP00
Species: Hu
Applications: ELISA
NBP2-01863
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-20619
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94256
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
NB200-585
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
DCP00
Species: Hu
Applications: ELISA
7268-CT
Species: Hu
Applications: BA
NBP1-93674
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-82546
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB

Publications for NRIF3 Antibody (H00023421-M01) (0)

There are no publications for NRIF3 Antibody (H00023421-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRIF3 Antibody (H00023421-M01) (0)

There are no reviews for NRIF3 Antibody (H00023421-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NRIF3 Antibody (H00023421-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NRIF3 Products

Bioinformatics Tool for NRIF3 Antibody (H00023421-M01)

Discover related pathways, diseases and genes to NRIF3 Antibody (H00023421-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRIF3 Antibody (H00023421-M01)

Discover more about diseases related to NRIF3 Antibody (H00023421-M01).
 

Pathways for NRIF3 Antibody (H00023421-M01)

View related products by pathway.

PTMs for NRIF3 Antibody (H00023421-M01)

Learn more about PTMs related to NRIF3 Antibody (H00023421-M01).
 

Research Areas for NRIF3 Antibody (H00023421-M01)

Find related products by research area.

Blogs on NRIF3

There are no specific blogs for NRIF3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRIF3 Antibody (3F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB3BP
Entrez
OMIM
Uniprot