NPAS2 Antibody (6C9)

Western Blot: NPAS2 Antibody (6C9) [H00004862-M03] - Analysis of NPAS2 expression in transfected 293T cell line by NPAS2 monoclonal antibody (M03), clone 6C9. Lane 1: NPAS2 transfected lysatE (91.8 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 6C9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

NPAS2 Antibody (6C9) Summary

• Immunogen: NPAS2 (NP_002509, 646 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH
• Specificity: NPAS2 (6C9)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NPAS2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NPAS2 Antibody (6C9)

• Basic-helix-loop-helix-PAS protein MOP4
• BHLHE9
• bHLHe9MGC71151
• Class E basic helix-loop-helix protein 9
• Member of PAS protein 4
• member of PAS superfamily 4
• MOP4PAS domain-containing protein 4
• neuronal PAS domain protein 2
• neuronal PAS domain-containing protein 2
• Neuronal PAS2
• PASD4FLJ23138

Background

The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. A similar mouse protein may play a regulatory role in the acquisition of specific types of memory. It also may function as a part of a molecular clock operative in the mammalian forebrain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPAS2
• Entrez:
  • 4862(Human)
• OMIM:
  • 603347(Human)
• Uniprot:
  • NP_002509(Human)