NPAS2 Antibody (6C9)

Images

 
Western Blot: NPAS2 Antibody (6C9) [H00004862-M03] - Analysis of NPAS2 expression in transfected 293T cell line by NPAS2 monoclonal antibody (M03), clone 6C9. Lane 1: NPAS2 transfected lysatE (91.8 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6C9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NPAS2 Antibody (6C9) Summary

Immunogen
NPAS2 (NP_002509, 646 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH
Specificity
NPAS2 (6C9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NPAS2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NPAS2 Antibody (6C9)

  • Basic-helix-loop-helix-PAS protein MOP4
  • BHLHE9
  • bHLHe9MGC71151
  • Class E basic helix-loop-helix protein 9
  • Member of PAS protein 4
  • member of PAS superfamily 4
  • MOP4PAS domain-containing protein 4
  • neuronal PAS domain protein 2
  • neuronal PAS domain-containing protein 2
  • Neuronal PAS2
  • PASD4FLJ23138

Background

The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. A similar mouse protein may play a regulatory role in the acquisition of specific types of memory. It also may function as a part of a molecular clock operative in the mammalian forebrain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, KO
NB100-125
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
NBP2-24589
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IB, IHC, IHC-P, KO
21670002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-69080
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86436
Species: Hu
Applications: IHC, IHC-P
NB100-135
Species: Hu, Pm, Bv(-), Ch(-), Rt(-), Ze(-)
Applications: WB, ICC/IF
NBP1-69032
Species: Mu
Applications: WB
NBP1-85296
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-83996
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88027
Species: Hu, Mu, Rt, Eq
Applications: WB, Simple Western, IHC, IHC-P
NBP1-19613
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-1800
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ChIP, CHIP-SEQ
H00009572-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, PEP-ELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for NPAS2 Antibody (H00004862-M03) (0)

There are no publications for NPAS2 Antibody (H00004862-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPAS2 Antibody (H00004862-M03) (0)

There are no reviews for NPAS2 Antibody (H00004862-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NPAS2 Antibody (H00004862-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NPAS2 Products

Bioinformatics Tool for NPAS2 Antibody (H00004862-M03)

Discover related pathways, diseases and genes to NPAS2 Antibody (H00004862-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPAS2 Antibody (H00004862-M03)

Discover more about diseases related to NPAS2 Antibody (H00004862-M03).
 

Pathways for NPAS2 Antibody (H00004862-M03)

View related products by pathway.

PTMs for NPAS2 Antibody (H00004862-M03)

Learn more about PTMs related to NPAS2 Antibody (H00004862-M03).

Blogs on NPAS2

There are no specific blogs for NPAS2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPAS2 Antibody (6C9) and receive a gift card or discount.

Bioinformatics

Gene Symbol NPAS2
Entrez
OMIM
Uniprot