Recombinant Human NOXO1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NOXO1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 100 of Human NOXO1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKTLKETFPVEAGLLRRSDRVLPKLLDAPLLGRVGRTSRGLARLQLLETYSRR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NOXO1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 100 mM NaCl, pH 8.0, 5 mM DTT, 4 mM reduced glutathione, 20% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NOXO1 Protein

  • MGC20258
  • NADPH oxidase organizer 1
  • Nox organizer 1
  • Nox-organizing protein 1
  • P41NOX
  • P41NOXA
  • P41NOXB
  • P41NOXC
  • regulatory protein P41NOX
  • SH3 and PX domain-containing protein 5
  • SH3PXD5NADPH oxidase regulatory protein
  • SNX28

Background

NOXO1 - NADPH oxidase organizer 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92197
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5758
Species: Hu
Applications: WB, IHC, ICC
MAB1904
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-40974
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82542
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
AF3795
Species: Hu
Applications: WB, IP
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NOXO1 Partial Recombinant Protein (H00124056-Q01) (0)

There are no publications for NOXO1 Partial Recombinant Protein (H00124056-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOXO1 Partial Recombinant Protein (H00124056-Q01) (0)

There are no reviews for NOXO1 Partial Recombinant Protein (H00124056-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NOXO1 Partial Recombinant Protein (H00124056-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NOXO1 Products

Bioinformatics Tool for NOXO1 Partial Recombinant Protein (H00124056-Q01)

Discover related pathways, diseases and genes to NOXO1 Partial Recombinant Protein (H00124056-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOXO1 Partial Recombinant Protein (H00124056-Q01)

Discover more about diseases related to NOXO1 Partial Recombinant Protein (H00124056-Q01).
 

Pathways for NOXO1 Partial Recombinant Protein (H00124056-Q01)

View related products by pathway.

PTMs for NOXO1 Partial Recombinant Protein (H00124056-Q01)

Learn more about PTMs related to NOXO1 Partial Recombinant Protein (H00124056-Q01).
 

Research Areas for NOXO1 Partial Recombinant Protein (H00124056-Q01)

Find related products by research area.

Blogs on NOXO1

There are no specific blogs for NOXO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NOXO1 Antibody
NB300-950
NOX1 Antibody
NBP1-31546

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NOXO1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NOXO1